Recombinant Vitis vinifera Photosystem Q (B) protein (psbA)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order. We will fulfill your request to the best of our ability.
Lead Time
Delivery times may vary depending on the purchase method and location. Please contact your local distributors for specific delivery timelines.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freeze-thaw cycles are not recommended. For optimal stability, store working aliquots at 4°C for up to one week.
Reconstitution
Prior to opening, it is recommended to briefly centrifuge the vial to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final concentration of glycerol is 50%, which can be used as a reference.
Shelf Life
The shelf life is influenced by several factors, including storage conditions, buffer components, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us and we will prioritize its development.
Synonyms
psbA; Photosystem II protein D1; PSII D1 protein; Photosystem II Q(B protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-344
Protein Length
full length protein
Species
Vitis vinifera (Grape)
Target Names
psbA
Target Protein Sequence
MTVILERRESESLWGRFCNWITSTENRLYIGWFGVLMIPTLLTATSVFIIAFIAAPPVDI DGIREPVSGSLLYGNNIISGAIIPTSAAIGLHFYPIWEAASVDEWLYNGGPYELIVLHFL LGVACYMGREWELSFRLGMRPWIAVAYSAPVAAAAAVFLIYPIGQGSFSDGMPLGISGTF NFMIVFQAEHNILMHPFHMLGVAGVFGGSLFSAMHGSLVTSSLIRETTENESANAGYRFG QEEETYNIVAAHGYFGRLIFQYASFNNSRSLHFFLAAWPVVGIWFTALGISTMAFNLNGF NFNQSVVDSQGRVINTWADIINRANLGMEVMHERNAHNFPLDLA
Uniprot No.

Target Background

Function
Photosystem II (PSII) is a light-driven water:plastoquinone oxidoreductase that harnesses light energy to extract electrons from H2O, generating O2 and a proton gradient that drives ATP formation. It comprises a core antenna complex responsible for capturing photons and an electron transfer chain that converts photonic excitation into charge separation. The D1/D2 (PsbA/PsbA) reaction center heterodimer binds P680, the primary electron donor of PSII, along with several subsequent electron acceptors.
Database Links
Protein Families
Reaction center PufL/M/PsbA/D family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is the psbA gene in Vitis vinifera and what protein does it encode?

The psbA gene in Vitis vinifera (common grape) encodes the D1 protein, a core component of Photosystem II (PSII). This protein plays a crucial role in the electron transfer processes during photosynthesis and is located in the chloroplast genome. The D1 protein is essential for the water-splitting reaction in photosynthesis and contains binding sites for various cofactors involved in electron transport. Unlike many nuclear-encoded proteins, the psbA gene is part of the highly conserved chloroplast genome, making it valuable for both evolutionary studies and photosynthesis research .

Why is recombinant expression of psbA protein valuable for research?

Recombinant expression of the psbA protein enables detailed structural and functional studies that would be difficult with naturally isolated proteins. By expressing the protein in heterologous systems, researchers can introduce specific mutations, add protein tags for purification, and produce higher quantities than would be possible from natural sources. This approach allows for studying specific domains and functional regions of the protein, understanding how sequence variations affect function, and facilitating protein-protein interaction studies. Additionally, recombinant expression provides a consistent source of protein for experimental reproducibility across different research groups .

What expression systems are most effective for recombinant Vitis vinifera psbA protein production?

The selection of an appropriate expression system for recombinant psbA protein depends on research objectives and downstream applications:

Expression SystemAdvantagesLimitationsBest For
E. coliHigh yield, rapid growth, economicalLacks post-translational modifications, inclusion body formation commonStructural studies, antibody production
Yeast (S. cerevisiae)Eukaryotic processing, moderate yieldMore expensive than bacterial systemsFunctional studies requiring folding
Plant-based systemsNative-like modifications, proper foldingLower yield, longer production timeFunctional assays, interaction studies
Cell-free systemsAvoids toxicity issues, rapidExpensive, limited scaleDifficult-to-express variants

For most functional studies, yeast expression systems have demonstrated superior results due to their ability to handle membrane proteins more effectively than bacterial systems . When using bacterial systems, fusion partners such as thioredoxin or MBP (maltose-binding protein) can improve solubility of the recombinant psbA protein.

What are the critical considerations when designing primers for amplifying the psbA gene from Vitis vinifera?

When designing primers for psbA amplification, researchers must consider several critical factors:

  • Chloroplast genome specificity: Design primers that specifically target chloroplast DNA to avoid nuclear pseudogene amplification.

  • Restriction site inclusion: Include appropriate restriction sites for subsequent cloning, ensuring they don't exist within the target sequence.

  • Codon optimization: Consider codon optimization for the intended expression system, particularly when moving from plant to bacterial or yeast systems.

  • Full sequence coverage: For complete gene studies, ensure primers cover the entire coding region including start and stop codons.

  • Annealing temperature compatibility: Design primer pairs with similar melting temperatures (within 2-3°C).

Typical amplification protocols involve initial denaturation at 94-95°C for 3-5 minutes, followed by 30-35 cycles of denaturation (94°C, 30s), annealing (55-58°C, 30s), and extension (72°C, 1 minute per kb), with a final extension at 72°C for 7-10 minutes .

What purification methods yield the highest purity for recombinant psbA protein?

Purification of recombinant psbA protein requires specialized approaches due to its hydrophobic nature and membrane association:

  • Affinity chromatography: Histidine tags (6×His) enable purification using Ni-NTA resins, though elution conditions must be optimized to maintain protein structure.

  • Size exclusion chromatography: Essential as a second step to remove aggregates and achieve higher purity.

  • Detergent selection: Critical for solubilization; mild detergents like n-dodecyl β-D-maltoside (DDM) or digitonin preserve protein function better than harsher alternatives.

  • Buffer optimization: Phosphate bufffers (pH 7.2-7.8) containing glycerol (10-15%) and appropriate detergent concentrations improve stability during purification.

The typical yield from optimized systems ranges from 0.5-5 mg/L of culture, with purity levels reaching >90% after a two-step purification process .

How can site-directed mutagenesis be used to study functional domains in psbA protein?

Site-directed mutagenesis provides powerful insights into structure-function relationships within the psbA protein. Key approaches include:

  • Identification of target residues: Based on sequence alignments across species, known binding domains, or computational prediction of functional residues.

  • Mutagenesis strategy: Single amino acid substitutions are most common, particularly changing conserved residues to alanine (alanine scanning) or to amino acids with different properties.

  • Functional assays: Following mutagenesis, assess changes in:

    • Electron transport rates using artificial electron acceptors

    • Herbicide binding sensitivity

    • Protein stability under photooxidative stress

    • Assembly into functional PSII complexes

Specific residues in the D1 protein (psbA gene product) known to affect function include those in the QB binding pocket, which when mutated can alter herbicide sensitivity and electron transport kinetics . These studies help elucidate how environmental stresses affect photosynthetic efficiency in Vitis vinifera under different cultivation conditions.

What proteomic approaches can be used to study psbA protein interactions in Vitis vinifera?

Modern proteomic techniques offer sophisticated ways to analyze psbA protein interactions:

  • Co-immunoprecipitation (Co-IP): Using antibodies against tagged psbA to pull down interaction partners, followed by mass spectrometry identification.

  • Crosslinking mass spectrometry (XL-MS): Chemical crosslinkers stabilize transient interactions before digestion and MS analysis, providing spatial relationship data.

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS): Reveals dynamic protein interactions by measuring differential solvent accessibility.

  • Blue native PAGE: Separates intact protein complexes while maintaining native interactions, useful for studying PSII assembly.

  • iTRAQ-based quantitative proteomics: Allows comparison of interaction profiles under different environmental conditions.

These approaches have revealed that the psbA protein interacts not only with other PSII components but also with various repair and assembly factors that change in abundance during stress responses . For example, proteomic analysis has identified differential expression of proteins associated with photosynthesis between resistant wild grapevines and susceptible Vitis vinifera cultivars during pathogen infection.

What are the most reliable methods for assessing psbA gene expression in Vitis vinifera under stress conditions?

Accurate assessment of psbA expression requires careful selection of methods based on experimental objectives:

  • Quantitative RT-PCR (RT-qPCR): Provides high sensitivity for transcript quantification, requiring:

    • Careful reference gene selection (actin, ubiquitin, or EF1α are typically stable in grapevine tissues)

    • RNA quality assessment (RIN > 8.0)

    • Optimization of reverse transcription conditions

  • RNA-Seq: Offers comprehensive transcriptome analysis, allowing psbA expression to be viewed in context of global expression changes.

  • Protein-level assessment:

    • Western blotting with psbA-specific antibodies

    • Targeted proteomics approaches (SRM/MRM-MS)

    • Fluorescent protein fusions for localization studies

For stress studies, time-course experiments with multiple sampling points (0, 8, 24, and 48 hours post-treatment) are recommended to capture both early signaling events and later adaptive responses . Expression changes should be correlated with physiological measurements such as chlorophyll fluorescence parameters (Fv/Fm) to connect transcript changes with functional effects.

How can chloroplast transformation be used to modify psbA in Vitis vinifera?

Chloroplast transformation represents an advanced approach for psbA modification in Vitis vinifera:

  • Vector design considerations:

    • Homologous recombination regions flanking insertion site

    • Selectable marker (typically spectinomycin resistance)

    • Regulatory elements (promoters, 5' UTR, 3' UTR from endogenous chloroplast genes)

  • Transformation methods:

    • Biolistic bombardment of embryogenic callus

    • PEG-mediated transformation of protoplasts

  • Selection and regeneration:

    • Initial selection on spectinomycin-containing media

    • Multiple rounds of regeneration to achieve homoplasmy

    • Confirmation by PCR and Southern blotting

  • Verification of transgene function:

    • Transcript analysis

    • Protein accumulation assessment

    • Photosynthetic parameter measurements

What bioinformatic tools are most useful for analyzing sequence variations in psbA across Vitis species?

Bioinformatic analysis of psbA sequences across Vitis species requires specialized tools and approaches:

  • Sequence retrieval and alignment:

    • Specialized chloroplast genome databases (Chloroplast DB, DOGMA)

    • Multiple sequence alignment tools (MAFFT or MUSCLE for accuracy with highly conserved sequences)

  • Polymorphism and variation analysis:

    • DnaSP for nucleotide diversity (π) and haplotype diversity calculations

    • MEGA software for selection analysis (Ka/Ks ratios)

  • Structural prediction:

    • Homology modeling based on available photosystem crystal structures

    • Assessment of how sequence variations map to functional domains

  • Phylogenetic analysis:

    • Maximum likelihood or Bayesian approaches for tree construction

    • AMOVA or SAMOVA for population structure analysis

These analyses can reveal evidence of selection patterns and identify conserved regions essential for function versus variable regions that may contribute to species-specific adaptations . When analyzing the trnH-psbA intergenic spacer, attention to indels (insertions/deletions) is particularly important as they can serve as useful markers for species identification.

How do post-translational modifications affect the function of psbA protein in Vitis vinifera?

Post-translational modifications (PTMs) significantly impact psbA protein function and turnover:

  • Phosphorylation:

    • Occurs primarily under high light stress

    • Affects D1 protein turnover rate and PSII repair cycle

    • Can be detected using phospho-specific antibodies or phosphoproteomic approaches

  • Oxidative modifications:

    • Carbonylation increases under stress conditions

    • Triggers degradation and replacement of damaged D1 protein

    • Quantifiable using derivatization techniques coupled with mass spectrometry

  • N-terminal processing:

    • Essential for proper integration into PSII complexes

    • Involves specific protease activities

  • Methodological approaches for PTM detection:

    • 2D-PAGE combined with western blotting

    • Enrichment strategies (TiO₂ for phosphopeptides)

    • LC-MS/MS with neutral loss scanning

    • Targeted mass spectrometry approaches

Studies have shown that grape varieties with differential stress tolerance may display distinct patterns of psbA post-translational modifications, potentially contributing to their adaptive capabilities . Research into these modifications can provide insights into mechanisms of photosynthetic acclimation to environmental challenges specific to viticulture.

What are common pitfalls in recombinant psbA protein expression and how can they be overcome?

Researchers frequently encounter several challenges when expressing recombinant psbA protein:

ChallengeCauseSolution
Low expression yieldProtein toxicity to host cellsUse tightly controlled inducible promoters; lower induction temperature (16-18°C)
Inclusion body formationImproper foldingCo-express with molecular chaperones; use solubility tags (SUMO, MBP)
Proteolytic degradationHost proteasesAdd protease inhibitors; use protease-deficient host strains
Loss of functionImproper cofactor incorporationSupplement growth media with required cofactors; verify protein folding
Aggregation during purificationHydrophobic interactionsOptimize detergent type and concentration; add glycerol (10-15%) to buffers

Additionally, codon optimization for the expression host is critical, as rare codons in the Vitis vinifera sequence can cause translational pausing and protein misfolding when expressed in bacterial or yeast systems . Fusion partners that enhance solubility can be used, though they must be removable without affecting protein function if subsequent functional studies are planned.

How can contradictory results in psbA functional studies be reconciled?

When facing contradictory results in psbA functional studies, systematic troubleshooting is essential:

  • Methodological variations:

    • Standardize protein preparation protocols

    • Ensure consistent detergent types and concentrations

    • Verify protein integrity by circular dichroism or fluorescence spectroscopy

  • Environmental variables:

    • Control light intensity precisely during functional assays

    • Maintain consistent temperature and pH conditions

    • Document growth conditions of plant material used for native comparisons

  • Genetic considerations:

    • Confirm sequence identity of expressed constructs

    • Check for unintended mutations introduced during cloning

    • Consider allelic variations between different Vitis vinifera cultivars

  • Statistical analysis:

    • Perform sufficient biological and technical replicates (minimum n=3)

    • Apply appropriate statistical tests for data validation

    • Consider Bayesian approaches for integrating contradictory datasets

Frequently, contradictions arise from subtle differences in experimental conditions rather than fundamental disagreements in findings . Creating detailed supplementary methods sections and standardized protocols can help minimize these discrepancies across research groups.

What quality control measures are essential when working with recombinant psbA protein?

Rigorous quality control ensures reliable and reproducible results when working with recombinant psbA protein:

  • Identity verification:

    • Mass spectrometry confirmation (MALDI-TOF or LC-MS/MS)

    • Western blotting with specific antibodies

    • N-terminal sequencing to confirm correct processing

  • Purity assessment:

    • SDS-PAGE with densitometry analysis (>95% purity recommended)

    • Size exclusion chromatography profiles

    • Dynamic light scattering to detect aggregation

  • Functional validation:

    • Circular dichroism to assess secondary structure

    • Binding assays with known ligands (herbicides, plastoquinone analogs)

    • Electron transport measurements compared to native controls

  • Stability monitoring:

    • Thermal shift assays to determine melting temperature

    • Time-course activity measurements at storage temperature

    • Assessment after freeze-thaw cycles if applicable

Documentation of these quality control parameters should accompany all experimental data to ensure interpretability and reproducibility . Establishing acceptance criteria before experiments begins helps enforce consistent quality standards across studies.

How might CRISPR-Cas technologies be applied to study psbA function in Vitis vinifera?

CRISPR-Cas systems offer revolutionary approaches for studying psbA function in Vitis vinifera:

  • Chloroplast genome editing:

    • Direct modification of the psbA gene in its native context

    • Introduction of point mutations to study specific residues

    • Creation of knockout or knockdown lines for functional studies

  • Technical considerations:

    • Delivery of CRISPR components to chloroplasts (biolistic transformation)

    • Design of plastid-optimized Cas9 variants

    • Selection of appropriate promoters for guide RNA expression

  • Potential applications:

    • Engineering herbicide resistance through targeted mutations

    • Improving photosynthetic efficiency under stress conditions

    • Creating reporter lines for monitoring D1 protein turnover in vivo

  • Validation approaches:

    • Sequencing to confirm edits

    • Protein expression analysis

    • Physiological characterization of photosynthetic parameters

While CRISPR-based chloroplast genome editing remains challenging in woody perennials like grapevine, recent advances in delivery methods and selection strategies are making this approach increasingly feasible . Combined with traditional transformation approaches, these technologies will enable unprecedented precision in manipulating photosynthetic apparatus components.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.