Recombinant Vitis vinifera Probable polygalacturonase (GSVIVT00026920001, LOC100243180)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a useful reference.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
GSVIVT00026920001; LOC100243180; Probable polygalacturonase; PG; Pectinase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-491
Protein Length
full length protein
Species
Vitis vinifera (Grape)
Target Names
GSVIVT00026920001
Target Protein Sequence
MVETHKKKIANLTQPIVSFYCFQVVSVLVAVVLLLSVSRGECRKGRILEALEYSAISCRA HSASLVDFGGVGDGQTLNTKAFQDAVSELSKYGSEGGAQLYVPAGKWLTGSFSLTSHFTL FLHRDAVLLASQDISQWPVIKPLPSYGRGRDAAAGRYTSLIFGTNLTDVIITGDNGTIDG QGGLWWQRFHGGKLKYTRPYLIELMYSADIQISNLTLLNSPSWNVHPVYSRNILIQGITI LAPVRSPNTDGINPDSCTNTRIEDCYIVSGDDCVAVKSGWDEYGIAYGMPTKQLVIRRLT CISPYSAVIALGSEMSGGIQDVRAEDIVAINSESGIRIKTGIGRGGYVKDIYVRGMTMKT MKWAFWMTGNYGSHADNHYDPKAFPVIQGINYRDMVAENVSMAARLEGIPSDPFTGICIS NVTIHLAAKAKKVPWTCTDVEGISSGVTPTPCSTLPDQGPEKTSLCNFPAESLPIDTVEL QKCSYGINYYP
Uniprot No.

Target Background

Protein Families
Glycosyl hydrolase 28 family
Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is Vitis vinifera polygalacturonase and what is its primary function?

Vitis vinifera polygalacturonase (PG) is a cell wall-degrading enzyme (EC 3.2.1.15) also known as pectinase that catalyzes the hydrolytic cleavage of α-1,4-glycosidic bonds in polygalacturonic acid. This enzyme plays critical roles in grape berry development, particularly during ripening processes . The gene encoding this enzyme in Vitis vinifera has been identified with ORF names GSVIVT00026920001 and LOC100243180, producing a protein with UniProt accession number A7PZL3 .

In grapevines, polygalacturonase functions primarily in cell wall modification during fruit development. Studies have demonstrated that specific PG isoforms, such as VvPG1, show expression patterns closely correlated with berry softening, particularly during veraison (the onset of ripening) . The enzyme facilitates this process by degrading pectin components of the cell wall, contributing to the textural changes observed during grape ripening.

How does Vitis vinifera polygalacturonase expression change during grape berry development?

The expression of different polygalacturonase isoforms follows distinct temporal patterns during grape berry development. Research using RT-PCR has revealed that:

  • VvPG1 transcript accumulation is closely correlated with berry softening, with expression markedly increasing during color change (veraison)

  • VvPG2 mRNA accumulation begins before veraison but remains relatively low during skin ripening

  • Phylogenetic analysis indicates that VvPG1 and VvPG2 belong to different groups, suggesting distinct functional roles during development

These findings indicate that VvPG1 likely plays a primary role in skin softening during ripening, while VvPG2 may be involved in triggering the ripening process itself. Interestingly, despite the presence of PG transcripts, direct measurement of polygalacturonase activity in skin tissue throughout berry development has not detected enzymatic activity, suggesting possible post-transcriptional regulation mechanisms .

What are the optimal storage and handling conditions for recombinant Vitis vinifera polygalacturonase?

For optimal preservation of enzyme activity, recombinant Vitis vinifera polygalacturonase should be stored according to these guidelines:

  • Storage buffer: Tris-based buffer with 50% glycerol, optimized for this specific protein

  • Temperature: Store at -20°C for routine storage; for extended storage, conserve at -20°C or -80°C

  • Working conditions: Store working aliquots at 4°C for up to one week

  • Freeze-thaw cycles: Repeated freezing and thawing is not recommended as it may compromise enzymatic activity

These storage conditions help maintain the structural integrity and catalytic activity of the enzyme for experimental applications.

What methodologies are most effective for measuring Vitis vinifera polygalacturonase activity in vitro?

Several established methods can be employed to measure polygalacturonase activity in experimental settings:

Reducing End-Group Analysis:
This approach quantifies the release of reducing sugars resulting from the hydrolysis of polygalacturonic acid. The method developed by Anthon and Barrett (2002) is particularly effective and has been successfully used in studies involving polygalacturonases . The procedure typically involves:

  • Incubating the enzyme (e.g., 5-36ng) with polygalacturonic acid substrate (0.1mg ml⁻¹) in appropriate buffer conditions (e.g., 50mM sodium acetate buffer at optimal pH, usually around 4.2-4.6)

  • Allowing the reaction to proceed at controlled temperature (commonly 30°C)

  • Measuring the production of reducing end groups using colorimetric assays

PG activity is typically expressed in μkat mg⁻¹ of protein, representing the amount of enzyme that catalyzes the formation of 1 μmol of reducing groups per second under the assay conditions .

HPLC Analysis:
High-performance liquid chromatography can be used to analyze the oligomeric products resulting from polygalacturonic acid degradation, providing detailed information about the mode of action (endo- vs. exo-activity) of the enzyme .

How can researchers study interactions between polygalacturonase and its inhibitors?

To study interactions between polygalacturonase and potential inhibitors such as polygalacturonase-inhibiting proteins (PGIPs) or inhibitory peptides, the following methodological approaches are effective:

Inhibition Assays:

  • Pre-incubate the polygalacturonase with the potential inhibitor (e.g., recombinant PGIP or synthetic peptide) for approximately 20 minutes at 30°C

  • Add the substrate (polygalacturonic acid) and continue incubation under standard assay conditions

  • Measure residual PG activity using reducing end-group analysis or other suitable methods

  • Express inhibition as the percentage reduction in reducing ends liberated by PGs in the presence versus absence of inhibitor

For example, when studying the peptide inhibitor SVTIHHLGGGS against Agrobacterium vitis polygalacturonase, researchers observed a 35% reduction in enzymatic activity using such methodology .

Computational Approaches:
Protein modeling and docking studies can provide insights into the structural basis of PG-inhibitor interactions. Techniques include:

  • Homology modeling of the polygalacturonase and inhibitor structures

  • Molecular docking simulations to predict binding modes

  • Computational mutagenesis to identify key residues involved in binding

  • Analysis of electrostatic surface potentials to understand the energetic basis of interactions

These computational approaches can guide experimental design by identifying promising inhibitor candidates or suggesting protein modifications to alter binding properties.

How does polygalacturonase function as a virulence factor in grapevine pathogens?

Polygalacturonase serves as a critical virulence factor for several pathogens that affect grapevines:

In Xylella fastidiosa, the causal agent of Pierce's disease, polygalacturonase enables systemic colonization of grapevine xylem vessels. The enzyme facilitates bacterial spread by degrading pit membrane pectins that separate adjacent xylem elements. Research has demonstrated that:

  • X. fastidiosa mutants with disrupted pglA gene (encoding polygalacturonase) lose pathogenicity

  • These mutants show compromised ability to systemically colonize Vitis vinifera grapevines

  • The X. fastidiosa PG shares approximately 65% amino acid identity with the endo-PG of Ralstonia solanacearum, another xylem-inhabiting bacterium

These findings establish that polygalacturonase is required for X. fastidiosa to successfully infect grapevines and represents a critical virulence factor in pathogenesis .

Similarly, Agrobacterium vitis, which causes crown gall disease in grapevines, produces polygalacturonase as a major virulence factor. This enzyme degrades pectin components of the xylem cell wall. Studies have shown that:

  • A. vitis mutants with disrupted polygalacturonase genes exhibit reduced pathogenicity

  • These mutants produce significantly fewer root lesions on grapevines

  • The peptide SVTIHHLGGGS can reduce A. vitis polygalacturonase activity by 35% in vitro

What strategies exist for inhibiting pathogen polygalacturonases to protect grapevines?

Several approaches have been investigated for inhibiting pathogen-derived polygalacturonases:

Peptide Inhibitors:
Phage display technology has been used to identify peptides with high binding affinity to pathogen polygalacturonases. For example, the peptide SVTIHHLGGGS reduced Agrobacterium vitis polygalacturonase activity by 35% in vitro. Further truncation studies revealed that the IHHL motif alone is sufficient for inhibition . These peptides showed sequence similarity to regions of Oryza sativa and Triticum urartu polygalacturonase-inhibiting proteins, suggesting a potential evolutionary basis for their inhibitory activity .

Polygalacturonase-Inhibiting Proteins (PGIPs):
Plants naturally produce PGIPs as part of their defense against pathogens. Research on recombinant PGIPs has demonstrated their effectiveness in inhibiting fungal polygalacturonases. The inhibitory activity can be characterized through:

  • Expressing recombinant PGIPs in suitable host systems

  • Purifying the inhibitory proteins

  • Conducting enzyme inhibition assays under various conditions (pH, temperature, inhibitor concentration)

  • Determining kinetic parameters of inhibition

How can transcriptomic analysis enhance understanding of polygalacturonase regulation in Vitis vinifera?

Transcriptomic approaches provide powerful tools for investigating the complex regulation of polygalacturonase genes during grape development and in response to various stimuli:

Expression Profiling:
RT-PCR analysis has already revealed distinct temporal expression patterns for different PG isoforms (VvPG1 and VvPG2) during berry development . More comprehensive RNA-Seq approaches can:

  • Provide genome-wide context for PG expression relative to other cell wall-modifying enzymes

  • Identify co-regulated genes that may function in coordinated developmental pathways

  • Detect novel PG isoforms or splice variants not previously characterized

  • Quantify absolute transcript abundance with greater precision than traditional methods

Differential Expression Analysis:
Comparing transcriptomes across multiple conditions can reveal how PG expression responds to:

  • Developmental transitions (pre-veraison, veraison, post-veraison)

  • Environmental factors (temperature, water availability, light intensity)

  • Pathogen challenge (using various pathogens or elicitors)

  • Hormone treatments (ethylene, abscisic acid, auxins)

Such studies can illuminate the regulatory networks controlling PG expression in different contexts.

What methodological approaches can investigate the role of polygalacturonase in cell wall remodeling during fruit ripening?

To elucidate the specific contributions of polygalacturonase to cell wall remodeling during grape ripening, researchers can employ several complementary approaches:

Cell Wall Fractionation and Analysis:

  • Extract and fractionate cell walls from grape tissues at different developmental stages

  • Quantify pectin content and degree of methylesterification in each fraction

  • Analyze structural changes in cell wall components using techniques such as FTIR spectroscopy, NMR, or mass spectrometry

  • Correlate these changes with the expression patterns and activity levels of different PG isoforms

Immunolocalization Studies:

  • Generate specific antibodies against VvPG1 and VvPG2

  • Use immunohistochemistry to visualize the spatial distribution of these enzymes in berry tissues

  • Combine with in situ hybridization to correlate protein localization with transcript accumulation

  • Use fluorescently labeled pectin-binding probes to monitor pectin degradation in relation to PG localization

Genetic Modification Approaches:

  • Employ CRISPR-Cas9 or RNAi techniques to selectively knock out or knock down specific PG isoforms

  • Create transgenic vines with altered expression of PG genes

  • Analyze resulting phenotypes, particularly focusing on berry development and textural properties

  • Perform detailed cell wall analyses in modified plants compared to controls

These methodological approaches can provide a comprehensive understanding of how polygalacturonase contributes to the complex process of cell wall remodeling during grape berry ripening, with implications for fruit quality and post-harvest characteristics.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.