Recombinant Streptomyces lividans pH-gated potassium channel KcsA (kcsA)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, but this can be adjusted to suit your needs.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
kcsA; skc1; pH-gated potassium channel KcsA; Streptomyces lividans K+ channel; SKC1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-160
Protein Length
full length protein
Species
Streptomyces lividans
Target Names
kcsA
Target Protein Sequence
MPPMLSGLLARLVKLLLGRHGSALHWRAAGAATVLLVIVLLAGSYLAVLAERGAPGAQLI TYPRALWWSVETATTVGYGDLYPVTLWGRLVAVVVMVAGITSFGLVTAALATWFVGREQE RRGHFVRHSEKAAEEAYTRTTRALHERFDRLERMLDDNRR
Uniprot No.

Target Background

Function

KcsA functions as a pH-gated potassium ion channel. A decrease in cytosolic pH from 7 to 4 triggers channel opening; however, the physiological significance of this pH-dependence remains unclear. The channel exhibits a monovalent cation selectivity profile: K+ > Rb+ > NH4+ >> Na+ > Li+.

Protein Families
Potassium channel family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the basic structure of the KcsA potassium channel?

KcsA is a 160-amino acid polypeptide that forms a tetrameric potassium channel in the cytoplasmic membrane of Streptomyces lividans. The channel consists of four identical subunits arranged symmetrically around a central pore. Each subunit contains two transmembrane helices (TM1 and TM2) connected by a pore region that includes the selectivity filter. The three-dimensional structure of KcsA has made it an essential model for understanding potassium channel architecture and function .

Methodological approach: Researchers typically express recombinant KcsA in E. coli followed by purification using Ni-agarose chromatography for structural studies. X-ray crystallography at resolutions of 2.5 Å or better has been pivotal in elucidating structural details of the channel, particularly conformational changes in the selectivity filter during ion conduction .

How does KcsA function under physiological conditions?

While it was initially thought that KcsA requires highly acidic intracellular pH (pH<5) to exhibit activity, more recent research demonstrates that KcsA can function at normal physiological pH in the presence of a potassium electrochemical gradient. Single-channel conductance and open probability increase as the extracellular potassium concentration is decreased. The channel's activity is sensitive to both membrane potential and the concentration gradient, indicating that gating depends on both components of the electrochemical potential .

Key functional parameters:

  • When [K⁺(in)]/[K⁺(ex)] is 200 mM/10 mM, chord conductance is 24 pS with subconductance of 15 pS

  • Open probability under these conditions reaches 0.9

  • Permeability series is K⁺ > Rb⁺ >>> Cs⁺

  • K⁺ selectivity over Rb⁺ is 1.2-fold and over Na⁺ is 12-fold

  • Channels are disrupted by intracellular Na⁺ and blocked by intracellular Ba²⁺

What is the molecular basis for pH-dependent gating in KcsA?

KcsA exhibits a dual-gating mechanism: activation by protons at the intracellular side followed by an inactivation process similar to C-type inactivation at the selectivity filter. EPR spectroscopy has demonstrated that the inner gate opens maximally at low pH regardless of the magnitude of single-channel open probability, suggesting that stationary gating primarily originates from rearrangements at the selectivity filter rather than the intracellular gate .

Methodological insights: Researchers use EPR spectroscopy to monitor conformational changes at different pH values, while electrophysiological recordings in planar lipid bilayers provide functional correlates. Crystal structures of wild-type and mutant channels (particularly the E71A mutant) have revealed large structural excursions of the selectivity filter during ion conduction, offering insights into available conformations during gating .

Why is KcsA mostly inactive in its native environment?

Although KcsA is activated by intracellular acidification, activation only occurs at highly acidic levels (below pH 5.0), while the intracellular pH of Streptomyces is fairly neutral. Consequently, the channel is expected to be closed most of the time in its host environment. Interestingly, a mutant strain of S. lividans with a deletion of the KcsA gene failed to exhibit any obvious phenotype, further complicating our understanding of KcsA's physiological role .

Research approaches: To study KcsA function under more physiological conditions, researchers have used genetic complementation assays with K⁺-auxotrophic E. coli (TK2420) and S. cerevisiae (SGY1528) to identify activatory or "gain-of-function" mutations that allow functional activity of KcsA in these physiological environments .

What molecular determinants govern ion selectivity in KcsA?

Experimental evidence: Mutation studies where one or both C-terminal arginines were converted to neutral residues demonstrated that:

  • Channels with a single C-terminal arginine remain highly selective for K⁺ over Mg²⁺, independent of medium pH

  • Channels where both C-terminal arginines have been replaced with neutral residues (159V:160L or 159N:160N) become selective for Mg²⁺ when pH is >7 and for K⁺ when pH is <7

How do mutations affect KcsA's ion selectivity and gating properties?

Gain-of-function mutations that allow KcsA to function at physiological pH cluster at the helix-bundle-crossing in both TM1 and TM2. Specific residues identified include H25, L105, A108, T112, W113, F114, E118, and Q119. These mutations appear to modify the gating mechanism to permit channel opening at neutral pH. Additionally, the E71A mutation in the pore helix has been shown to suppress inactivation, resulting in channels with higher open probability .

Methodological approach: Researchers employ random mutagenesis of the entire open reading frame of KcsA followed by selection for activatory mutations on low [K⁺] media. Functional phenotypes are confirmed through electrophysiological recordings and genetic complementation assays. The A108T and T112N mutations are among those that confer significant activatory effects .

What are the optimal methods for expressing and purifying functional KcsA for structural and functional studies?

Expression of recombinant KcsA typically involves cloning the gene into an expression vector with a His-tag for purification, transformation into E. coli, and induction of expression. Purification is achieved using Ni-agarose chromatography. The tetrameric structure can be maintained during purification by careful control of detergent concentration and avoiding excessive heating .

Optimization tips:

  • When assessing co-purification of PHB and polyP, Western blot analysis using anti-PHB IgG can detect PHB in both tetramers and monomers

  • PolyP can be detected in tetramers by o-toluidine blue stain

  • The length of polyP can be estimated by acrylamide gel electrophoresis

  • Identity of polyP can be confirmed by its complete degradation by treatment with scPPX1

  • Wild-type and mutant proteins typically contain 12 ± 5 residues per monomer unit of PHB and 60 ± 12 residues of polyP

What techniques are most effective for studying KcsA function in artificial membrane systems?

Planar lipid bilayer recordings represent the gold standard for functional characterization of KcsA. This approach allows precise control of pH, ion concentrations, and membrane potential. Single-channel recordings can reveal conductance properties, open probability, and ion selectivity under various conditions .

Methodological considerations:

  • KcsA functions well at normal physiological pH in the presence of a potassium electrochemical gradient

  • Channel activity is sensitive to both membrane potential and concentration gradient

  • For optimal recording conditions, asymmetric solutions with higher internal K⁺ (e.g., 200 mM internal/10 mM external) produce robust currents

  • Open probability can be modulated by adjusting pH, with acidic intracellular pH increasing channel opening

  • Heterotetramer assembly methods can be used to study the contribution of individual subunits to channel gating and inactivation

How can KcsA be visualized and studied in its native cellular environment?

Immunoelectron microscopy using specific antibodies against domains of KcsA lacking membrane-spanning regions allows visualization of the channel in S. lividans hyphae. This approach has revealed that KcsA is localized within numerous separated clusters between the outer face of the cytoplasm and the cell envelope in substrate hyphae of wild-type S. lividans .

Advanced techniques:

  • For immunolocalization, antibodies raised against the C-terminal region of KcsA (anti-C-KcsA) followed by secondary gold-labeled (~6 nm) antibodies can be used

  • Electron energy loss spectroscopy can be employed to track ions (particularly cesium, which can be detected better than potassium) at the cell envelope

  • Electron spectroscopic imaging provides further visual confirmation of channel localization and ion distribution

  • For comparison studies, a designed chromosomal disruption mutant (DK) lacking a functional KcsA gene can serve as a negative control

What is the physiological role of KcsA in Streptomyces lividans?

Despite extensive research, the precise physiological role of KcsA in S. lividans remains incompletely understood. The channel is mostly inactive at the neutral pH typical of the bacterial cytoplasm. Interestingly, deletion mutants lacking the KcsA gene show no obvious phenotype, suggesting either functional redundancy or a specialized role under specific conditions not routinely encountered in laboratory settings .

Research approaches: Genetic complementation assays using K⁺-auxotrophic bacteria and yeast strains have been valuable for studying KcsA function in cellular contexts. These systems allow screening for mutations that permit channel activity under physiological conditions and may provide insights into potential roles of the channel .

Which mutations enable KcsA to function at physiological pH?

Several key mutations have been identified that allow KcsA to function at neutral pH, clustered primarily at the helix-bundle-crossing in both TM1 and TM2. The most significant mutations include:

MutationLocationFunctional Effect
H25R/NTM1Activatory
L105CTM2Activatory
A108TTM2Major activatory
T112NTM2Activatory
W113RTM2Activatory
F114LTM2Activatory
E118ATM2Activatory
Q119LTM2Activatory
E71APore helixPrevents inactivation

Screening methodology: Random mutagenesis of the entire KcsA open reading frame followed by selection in K⁺-auxotrophic E. coli (TK2420) on low [K⁺] media (7.5 mM KCl) has proven effective for identifying these gain-of-function mutations. False positives can be eliminated by retransformation and confirmation of the functional phenotype .

How do heterotetrameric KcsA channels with mixed wild-type and mutant subunits behave?

Heterotetramers containing different combinations of wild-type and mutant subunits (particularly E71A) reveal how the network of interactions in individual protomers affects ionic conduction and channel inactivation. Studies suggest that inactivation is a cooperative process requiring contributions from multiple subunits. Cell-free protein synthesis followed by purification using sodium dodecyl sulfate-polyacrylamide gel electrophoresis has been used to produce such heterotetramers for functional studies .

Analytical approach: Single-channel recordings from heterotetramers allow researchers to determine how many mutant subunits are required to alter channel properties like inactivation kinetics and open probability. This approach has been particularly valuable for understanding the cooperative nature of channel gating and inactivation processes .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.