Recombinant Volvox carteri Cytochrome b6-f complex iron-sulfur subunit, chloroplastic (petC)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Volvox carteri Cytochrome b6-f Complex Iron-Sulfur Subunit, Chloroplastic (petC)

The Recombinant Volvox carteri Cytochrome b6-f complex iron-sulfur subunit, chloroplastic (petC), also known as the Rieske iron-sulfur protein (ISP), is a component of the cytochrome b6-f complex found in the chloroplasts of Volvox carteri (a green alga) . The cytochrome b6-f complex is a central membrane protein complex involved in electron transport during oxygenic photosynthesis .

  • Function: The cytochrome b6-f complex oxidizes plastoquinol (PQH2) and reduces plastocyanin, facilitating electron transfer between Photosystem II and Photosystem I .

  • Subunits: In Mastigocladus laminosus, the cytochrome b6-f complex comprises eight polypeptide subunits: petA (cyt f), petB (cyt b6), petC (Rieske ISP), and petD (subunit IV) .

  • Molecular Weights: The molecular weights of the subunits in spinach thylakoid membranes are 30.9 kDa (petA), 24.7 kDa (petB), 19.3 kDa (petC), and 17.5 kDa (petD) .

  • Prosthetic Groups: The subunits bind or coordinate five tightly bound metallo-redox prosthetic groups, including hemes f, bp, bn, and cn, and the 2Fe-2S Rieske iron-sulfur protein (ISP) .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms maintain stability for 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
petC; Cytochrome b6-f complex iron-sulfur subunit, chloroplastic; Plastohydroquinone:plastocyanin oxidoreductase iron-sulfur protein; Rieske iron-sulfur protein; ISP; RISP
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
30-206
Protein Length
Full Length of Mature Protein
Species
Volvox carteri (Green alga)
Target Names
petC
Target Protein Sequence
AAVSSEVPDMNKRNIMNLILLGGASLPVGSLALGYGAFFVPPSSGGGSGGQAAKDALGND IKANAWLATHQKGDRSLSQGLKGDPTYLIVTADGTIEKYGLNAVCTHLGCVVPWVAAENK FKCPCHGSQYNAEGKVVRGPAPLSLALAHCDVQEDGLVTFSTWSETDFRTGLEPWWA
Uniprot No.

Target Background

Function

Component of the cytochrome b6-f complex. This complex mediates electron transfer between Photosystem II (PSII) and Photosystem I (PSI), facilitates cyclic electron flow around PSI, and participates in state transitions.

Database Links
Subcellular Location
Plastid, chloroplast thylakoid membrane; Single-pass membrane protein.

Q&A

What is the Volvox carteri Cytochrome b6-f complex iron-sulfur subunit and what is its function?

The Cytochrome b6-f complex is a central hetero-oligomeric membrane protein complex in the electron transport chain of oxygenic photosynthesis. It functions as a plastoquinol-plastocyanin oxidoreductase, mediating both linear and PSI cyclic electron flow, and facilitates proton translocation across the thylakoid membrane .

In Volvox carteri, the iron-sulfur subunit (petC) is also known as the Rieske iron-sulfur protein (ISP) and contains a [2Fe-2S] cluster that plays a crucial role in electron transfer. This subunit is one of the four major subunits of the complex alongside cytochrome f (petA), cytochrome b6 (petB), and subunit IV (petD) . The petC protein specifically participates in the electron transfer pathway from plastoquinol to plastocyanin, contributing to the generation of the proton gradient used for ATP synthesis.

The protein's full name is officially listed as "Cytochrome b6-f complex iron-sulfur subunit, chloroplastic" with alternative names including "Plastohydroquinone:plastocyanin oxidoreductase iron-sulfur protein," "Rieske iron-sulfur protein," or abbreviated as "ISP" or "RISP" .

How is petC organized structurally and genetically in Volvox carteri?

The petC gene in Volvox carteri encodes a protein of 206 amino acids (positions 30-206 representing the mature protein after processing) . The amino acid sequence contains characteristic cysteine and histidine residues that coordinate the [2Fe-2S] cluster, critical for its function in electron transport.

The genetic organization of petC in V. carteri includes:

FeatureDetails
Gene NamepetC
Alternative Namesgon9, ISP, RISP
Genome LocationChloroplast genome
Protein Length206 amino acids (mature form)
Expression Region30-206
UniProt IDQ9SBN3

The protein contains the characteristic CXHXC motif necessary for coordination of the [2Fe-2S] cluster, which is highly conserved across photosynthetic organisms . Unlike its bacterial and mitochondrial counterparts (cytochrome bc1 complex), the b6f complex in V. carteri and other photosynthetic organisms contains unique structural elements including an additional c-type heme (cn) and bound chlorophyll a and β-carotene molecules .

What expression patterns does petC show in Volvox carteri?

The expression of petC in Volvox carteri shows cell type-specific patterns that reflect its multicellular organization. Studies using RNA sequencing and transcriptome analysis have revealed that:

  • PetC is predominantly expressed in the somatic cells of Volvox rather than in the reproductive cells (gonidia) .

  • Expression increases after cell cleavage and peaks after embryogenesis is completed, coinciding with the biosynthesis of the extracellular matrix .

  • Environmental factors significantly influence petC expression:

    • Low light conditions increase expression

    • Extended dark periods specifically promote expression

    • Heat stress reduces expression

    • Cold stress and wounding reduce expression

  • Interestingly, petC expression also increases after the addition of the sex-inducer protein, suggesting a connection between photosynthetic metabolism and sexual development in Volvox carteri .

These expression patterns highlight the complex regulation of photosynthetic components in multicellular organisms and suggest that petC may have functions beyond basic photosynthesis, potentially involving developmental processes specific to multicellular algae.

How do research methodologies for petC differ between unicellular and multicellular green algae?

Studying petC in multicellular Volvox carteri requires specialized approaches compared to unicellular models like Chlamydomonas reinhardtii:

  • Cell type separation techniques: Researchers must mechanically separate the somatic and reproductive cells before molecular analysis to achieve cell type-specific data. This typically involves:

    • Carefully disrupting the extracellular matrix

    • Sequential filtration steps

    • Density gradient centrifugation

  • Developmental stage synchronization: Unlike unicellular algae, studies in V. carteri require precise culture synchronization methods:

    • Temperature-controlled water baths (32°C)

    • Aeration by bubbling air

    • 16 hr light:8 hr dark cycle with controlled LED illumination (250 μEm⁻²s⁻¹ with 1:1 ratio of red and blue light)

  • Transcriptomic analysis: Cell type-specific transcriptome analysis using:

    • RNA extraction from separated cell populations

    • Next-generation sequencing

    • Specialized alignment to the V. carteri genome assembly

    • Comparative analysis with homologous genes in Chlamydomonas

  • Transformation strategies: Gene manipulation in V. carteri requires:

    • Specialized vectors with cell type-specific promoters

    • Biolistic transformation methods

    • Co-transformation with selectable markers

These methodological differences reflect the increased complexity of studying proteins in a multicellular context and highlight the importance of considering developmental stages and cell type heterogeneity in experimental design.

What approaches can be used to study the structure-function relationship of recombinant petC?

To investigate structure-function relationships of recombinant Volvox carteri petC, researchers can employ several complementary approaches:

  • Recombinant protein expression and purification:

    • Expression in E. coli systems with optimized codons

    • Inclusion of affinity tags determined during the production process

    • Storage in Tris-based buffer with 50% glycerol at -20°C or -80°C for extended storage

  • Spectroscopic analysis:

    • Absorption spectroscopy to characterize the [2Fe-2S] cluster

    • Flash photolysis experiments to study electron transfer kinetics

    • Comparative analysis with homologous proteins from other species

  • Crystallographic studies:

    • X-ray crystallography to determine high-resolution structure (2.5 Å or better)

    • Analysis of the rubredoxin-like membrane proximal domain

    • Comparison with structures from cyanobacteria and other green algae

  • Site-directed mutagenesis:

    • Targeted modification of cysteine and histidine residues that coordinate the [2Fe-2S] cluster

    • Analysis of electron transfer rates in mutant proteins

    • Investigation of the effects of mutations on complex assembly

  • Interaction studies:

    • Analysis of interactions with other components of the b6f complex

    • Investigation of the shuttle mechanism of the [2Fe-2S] protein between the membrane-bound PQH₂ electron/H⁺ donor and the cytochrome f acceptor

    • Characterization of the quinone exchange mechanism

How can CRISPR/Cas9 technology be applied to study petC function in Volvox carteri?

CRISPR/Cas9 genome editing offers powerful approaches for studying petC function in Volvox carteri:

  • Development of Volvox-specific CRISPR systems:

    • Adaptation of existing Cas9 vectors with species-specific regulatory sequences

    • Design of guide RNAs targeting the petC gene

    • Optimization of transformation protocols using biolistic methods

  • Creation of targeted petC mutations:

    • Knockout mutants to assess loss-of-function phenotypes

    • Introduction of point mutations to modify specific functional domains

    • Creation of tagged versions for localization studies

  • Phenotypic analysis of petC mutants:

    • Assessment of photosynthetic efficiency

    • Analysis of growth rates and development

    • Evaluation of phototactic responses

    • Examination of effects on sexual development

  • Verification of mutations:

    • PCR and sequencing to confirm gene modifications

    • RT-PCR to assess transcript levels

    • Western blot analysis to verify protein expression levels

    • Microscopy to observe any phenotypic changes

The CRISPR/Cas9 system has been adapted for use in Volvox carteri by inserting species-specific regulatory sequences and designing guide RNAs targeting genes of interest. After biolistic transformation, transformants can be selected and tested for guide RNA expression and Cas9 protein expression using RT-PCR and Western blot techniques, respectively .

What are the evolutionary implications of comparative studies of petC between Volvox carteri and Chlamydomonas reinhardtii?

Comparative studies of petC between multicellular Volvox carteri and its unicellular relative Chlamydomonas reinhardtii provide insights into the evolution of photosynthetic machinery during the transition to multicellularity:

  • Genomic comparison:

    • Despite the significant differences in organismal complexity, the two species have remarkably similar protein-coding potentials with approximately 14,500 predicted proteins each

    • The V. carteri genome (138 Mbp) is only 17% larger than that of C. reinhardtii (118 Mbp)

    • Both species have high intron content with over 90% of genes containing introns, though Volvox has longer median intron lengths (358 bp vs 174 bp)

  • Protein family evolution:

    • Rather than large-scale invention of new protein-coding genes, increased complexity in Volvox is associated with modifications of lineage-specific proteins

    • Volvox shows expansion of certain protein families, particularly those associated with the extracellular matrix

  • Conservation of core photosynthetic components:

    • The core structure and function of petC is highly conserved between the two species

    • Differences likely relate to regulation and expression patterns rather than fundamental changes in protein structure

  • Expression pattern divergence:

    • Cell type-specific expression in Volvox represents a major evolutionary innovation

    • Differential regulation of petC between somatic and reproductive cells reflects specialization of cell types

These comparative studies suggest that the evolution of multicellularity in volvocine algae involved the repurposing and redeployment of existing genes rather than the invention of entirely new genes, with changes in gene regulation playing a crucial role in the emergence of increased organismal complexity.

How does petC function relate to the channelrhodopsin-mediated photoreception in Volvox carteri?

The relationship between petC function in the photosynthetic electron transport chain and channelrhodopsin-mediated photoreception represents an interesting intersection of energy production and sensory systems in Volvox carteri:

  • Functional compartmentalization:

    • While petC is involved in photosynthetic electron transport in the chloroplast, channelrhodopsins (VChR1 and VChR2) are light-gated ion channels involved in photoresponses

    • Both petC and channelrhodopsins are predominantly expressed in somatic cells, which contain eyespots and are responsible for phototaxis

  • Spectral sensitivity and light adaptation:

    • PetC functions within the photosynthetic electron transport chain, which primarily utilizes red and blue light

    • VChR1 absorbs maximally at 540nm (low pH) or 500nm (high pH), while VChR2 absorbs at 460nm

    • These different spectral sensitivities allow the organism to respond differently to various light qualities and intensities

  • Coordinated regulation:

    • Environmental factors that affect petC expression (light intensity, dark periods, heat stress) also influence channelrhodopsin expression

    • Sexual development, triggered by the sex-inducer protein, leads to increased expression of both petC and channelrhodopsins, suggesting coordinated regulation of photosynthesis and photoreception during reproduction

  • Evolutionary implications:

    • The co-localization of photosynthetic and photoreceptive machinery in somatic cells suggests that the evolution of multicellularity in Volvox involved the functional specialization of cell types for both energy production and environmental sensing

    • This specialization required the coordinated regulation of genes involved in these distinct but related processes

This relationship highlights how multicellularity in Volvox carteri involves the integration of multiple light-responsive systems, with photosynthesis and photoreception working together to coordinate cellular activities and organismal behavior.

What are the most effective methods for isolating and purifying recombinant Volvox carteri petC?

Isolation and purification of recombinant Volvox carteri petC requires specialized approaches:

  • Recombinant expression systems:

    • E. coli expression systems with codon optimization for heterologous expression

    • Inclusion of appropriate tags (determined during production process) for purification

    • Expression under controlled conditions to maintain protein stability

  • Purification protocol:

    • Lysis of bacterial cells containing recombinant protein

    • Initial purification using affinity chromatography based on included tag

    • Secondary purification using ion exchange or size exclusion chromatography

    • Storage in Tris-based buffer with 50% glycerol to maintain stability

  • Quality control measures:

    • SDS-PAGE to assess purity

    • Western blotting to confirm identity

    • Spectroscopic analysis to verify proper folding and [2Fe-2S] cluster incorporation

    • Avoiding repeated freeze-thaw cycles to prevent protein degradation

  • Working with purified protein:

    • Store stock solution at -20°C or -80°C for extended storage

    • Prepare working aliquots and store at 4°C for up to one week

    • Be aware that the [2Fe-2S] cluster is sensitive to oxidation and may require reducing conditions

Following these methodological guidelines will help ensure the isolation of high-quality recombinant petC suitable for downstream structural and functional studies.

What techniques are available for studying cell type-specific expression of petC in Volvox carteri?

Investigating the cell type-specific expression of petC in Volvox carteri requires specialized techniques that account for its multicellular nature:

  • Cell type separation and RNA extraction:

    • Mechanical separation of somatic and reproductive cells

    • RNA extraction from purified cell populations

    • Quality control of RNA using spectrophotometric and electrophoretic methods

  • Transcriptomic analysis:

    • RNA sequencing of separated cell types

    • Alignment to the V. carteri genome (available on Phytozome)

    • Normalization and statistical analysis using platforms such as ReadXplorer and DESeq

    • Implementation of appropriate cutoffs (e.g., baseMean expression value >12.5) for robust expression analysis

  • Cell type-specific promoter analysis:

    • Identification of cell type-specific promoters through transcriptome data screening

    • Cloning of promoter regions upstream of reporter genes (e.g., luciferase)

    • Transformation using particle bombardment

    • Analysis of reporter gene expression at both transcript and protein levels

  • Immunolocalization:

    • Development of antibodies specific to petC

    • Fixation and sectioning of Volvox colonies

    • Immunofluorescence microscopy to visualize protein localization

    • Co-localization with cell type-specific markers

These methods allow researchers to determine not only the levels of petC expression in different cell types but also to investigate the regulatory mechanisms controlling its cell type-specific expression in the context of multicellularity.

How can researchers effectively compare petC function across different green algae species?

Comparative studies of petC function across different green algae species require integrated approaches:

  • Sequence alignment and phylogenetic analysis:

    • Collection of petC sequences from diverse green algae

    • Multiple sequence alignment using BLOSUM scoring matrices

    • Phylogenetic tree construction to visualize evolutionary relationships

    • Identification of conserved domains and species-specific variations

  • Structural comparison:

    • Homology modeling based on available crystal structures

    • Analysis of [2Fe-2S] cluster coordination

    • Comparison of the rubredoxin-like membrane proximal domain

    • Identification of structural features that might influence function

  • Functional complementation studies:

    • Expression of petC genes from different species in a common host

    • Analysis of electron transfer efficiency

    • Assessment of protein stability and complex assembly

    • Identification of species-specific functional adaptations

  • Comparative expression analysis:

    • RNA-seq data comparison across species

    • Analysis of expression patterns in response to environmental stimuli

    • Investigation of regulatory elements controlling expression

    • Correlation of expression patterns with ecological niches

These comparative approaches can reveal how petC function has evolved across green algae with different levels of complexity, from unicellular species like Chlamydomonas to colonial species like Volvox, providing insights into the role of photosynthetic machinery in the evolution of multicellularity.

What are promising areas for future research on Volvox carteri petC?

Several promising research directions could advance our understanding of Volvox carteri petC:

  • Integration with developmental biology:

    • Investigation of petC's role in the developmental program of Volvox

    • Analysis of how petC expression changes during the transition from asexual to sexual reproduction

    • Exploration of the relationship between photosynthesis and multicellular development

  • Application of new genetic tools:

    • Further development of CRISPR/Cas9 systems for precise genome editing

    • Creation of conditional knockout systems to study essential functions

    • Development of optogenetic tools to manipulate petC function in real-time

  • Systems biology approaches:

    • Integration of transcriptomic, proteomic, and metabolomic data

    • Modeling of electron transport dynamics in different cell types

    • Network analysis to understand how petC functions within the broader cellular context

  • Ecological and evolutionary studies:

    • Field studies to understand petC function in natural environments

    • Comparative analysis across the volvocine lineage to track evolutionary changes

    • Investigation of adaptations to different light environments

These research directions could significantly enhance our understanding of how photosynthetic machinery functions in the context of multicellularity and provide insights into the evolution of complex photosynthetic organisms.

How might understanding petC function contribute to broader research on photosynthesis and multicellularity?

Research on Volvox carteri petC has broader implications for our understanding of photosynthesis and multicellularity:

  • Evolution of photosynthetic machinery:

    • Insights into how photosynthetic components adapt during the transition to multicellularity

    • Understanding of how electron transport systems evolve in response to new organizational challenges

    • Clarification of the relationship between photosynthetic efficiency and organismal complexity

  • Cell type specialization:

    • Elucidation of how photosynthetic machinery becomes specialized in different cell types

    • Understanding of how energy production is coordinated across a multicellular organism

    • Insights into the regulatory mechanisms controlling cell type-specific gene expression

  • Integration of signaling systems:

    • Clarification of how photosynthetic electron transport integrates with light sensing and behavioral responses

    • Understanding of the relationship between metabolism and development

    • Insights into how environmental signals are processed in multicellular contexts

  • Applied photosynthesis research:

    • Development of new approaches for engineering photosynthesis

    • Insights that could enhance biofuel production in algal systems

    • Understanding that might contribute to improved crop photosynthesis

By studying petC in the context of Volvox carteri's multicellularity, researchers can gain unique insights that bridge the gap between photosynthesis research and developmental biology, potentially leading to breakthroughs in our understanding of both fields.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.