Recombinant Vombatus ursinus NADH-ubiquinone oxidoreductase chain 4L (MT-ND4L)

Shipped with Ice Packs
In Stock

Description

Protein Structure and Functional Overview

MT-ND4L is a 98-amino-acid (11 kDa) transmembrane protein encoded by the mitochondrial gene MT-ND4L (UniProt ID: Q8W9B6). It forms part of NADH dehydrogenase (Complex I), the largest enzyme complex in the electron transport chain (ETC). Key structural and functional features include:

PropertyDetails
Gene LocationMitochondrial DNA (bases 10,469–10,765 in humans; overlapped with MT-ND4)
Protein RoleCore subunit of Complex I; facilitates electron transfer from NADH to ubiquinone
Key DomainsHydrophobic transmembrane regions; hydrophilic peripheral arm for redox activity
Mutation ImpactT10663C (Val65Ala) linked to Leber’s Hereditary Optic Neuropathy (LHON)

MT-ND4L’s hydrophobic domains anchor Complex I to the mitochondrial inner membrane, while its hydrophilic regions interact with flavin mononucleotide (FMN) and iron-sulfur clusters for electron transfer .

Clinical and Research Significance

MT-ND4L variants have been implicated in mitochondrial dysfunction and metabolic disorders:

Leber’s Hereditary Optic Neuropathy (LHON)

  • Mutation: T10663C (Val65Ala) disrupts Complex I function, reducing ATP production and causing optic nerve degeneration .

  • Mechanism: Impaired electron transfer leads to reactive oxygen species (ROS) accumulation, particularly damaging to retinal ganglion cells .

Metabolic Disorders

  • Association: MT-ND4L variants correlate with elevated BMI, obesity, and type 2 diabetes in adults .

  • Metabolomics Links: A G>A mutation at position 10,689 in MT-ND4L alters phosphatidylcholine (PC) ratios (e.g., PC ae C36:3/PC aa C36:6), indicating disrupted lipid metabolism .

Applications in Research

The recombinant MT-ND4L protein is utilized in:

ApplicationDetails
Complex I AssemblyStudies on subunit interactions and electron transfer kinetics
LHON ModelingFunctional assays to mimic Val65Ala mutation effects in vitro
Therapeutic DevelopmentScreening inhibitors/activators of Complex I for mitochondrial diseases
Structural BiologyCryo-EM or X-ray crystallography to resolve membrane domain architecture

For example, protein synthesis services (e.g., Liberum Bio) offer custom MT-ND4L production starting at $99 + $0.30/amino acid, enabling scalable studies on species-specific isoforms .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
MT-ND4L; MTND4L; NADH4L; ND4L; NADH-ubiquinone oxidoreductase chain 4L; NADH dehydrogenase subunit 4L
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-98
Protein Length
full length protein
Species
Vombatus ursinus (Common wombat)
Target Names
Target Protein Sequence
MTSISLNLIMAFSLALAGVLIYRSHLMSTLLCLEGMMLSLFILMALLISHFHMLSVSMAP LILLVFSACEAGVGLALLVKTSTDYGNDYVQNLNLLQC
Uniprot No.

Target Background

Function
A core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I). It catalyzes electron transfer from NADH through the respiratory chain, utilizing ubiquinone as the electron acceptor.
Protein Families
Complex I subunit 4L family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is the function of MT-ND4L in mitochondrial respiration?

MT-ND4L (NADH dehydrogenase 4L) functions as a core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I). This complex is essential for the first step in the electron transport process, transferring electrons from NADH to ubiquinone. This process creates an unequal electrical charge on either side of the inner mitochondrial membrane, providing energy for ATP production through oxidative phosphorylation .

Complex I contains multiple enzyme complexes embedded in the inner mitochondrial membrane that carry out chemical reactions driving ATP production. MT-ND4L specifically contributes to the maintenance of the electron transfer pathway within this system .

How does recombinant MT-ND4L differ from native protein?

Recombinant Vombatus ursinus MT-ND4L is produced through heterologous expression systems, which may include tag sequences for purification and detection. The specific tag type is typically determined during the production process. The recombinant protein is stored in Tris-based buffer with 50% glycerol, optimized for stability .

While the recombinant protein maintains the primary sequence of the native protein, post-translational modifications present in the native protein may be absent in the recombinant version, depending on the expression system used. This is an important consideration when using recombinant MT-ND4L for functional studies .

What are the recommended storage conditions for recombinant MT-ND4L?

For optimal stability, recombinant MT-ND4L should be stored at -20°C. For extended storage, conservation at -80°C is recommended. Working aliquots can be stored at 4°C for up to one week. Repeated freezing and thawing should be avoided as this can lead to protein degradation and loss of activity .

What techniques are most effective for studying MT-ND4L gene expression and protein function?

Several complementary approaches have proven effective for studying MT-ND4L:

  • RNA interference (RNAi): For targeting MT-ND4L expression, researchers have developed specific constructs. For example, the pND4L-RNAi plasmid has been used successfully to suppress gene expression .

  • Base editing technology: The MitoKO DdCBE (double-stranded-DNA deaminase-derived cytosine base editors) library has been optimized for precise ablation of mtDNA protein-coding genes, including MT-ND4L. This technique has shown high on-target activity of approximately 40-65% heteroplasmy .

  • Complex I activity assays: After manipulating MT-ND4L expression, respiratory chain complex activities can be measured using spectrophotometric methods. The absence of ND4L polypeptides prevents the assembly of the 950-kDa whole complex I and suppresses enzyme activity .

  • Long PCR amplification: Mitochondrial genomes can be amplified into two long fragments using LA Taq DNA polymerase. This approach facilitates comprehensive analysis of mtDNA sequences, including MT-ND4L .

How can researchers assess the impact of MT-ND4L mutations on mitochondrial function?

Assessment of MT-ND4L mutations requires a multi-parameter approach:

Assessment MethodParameters MeasuredAdvantages
Oxygen consumption rateBasal respiration, maximal respiration, spare capacityDirect measure of mitochondrial respiratory function
Blue native PAGEComplex I assembly and stabilityVisualizes intact respiratory complexes
NAD+/NADH ratio measurementRedox stateIndicates electron transport efficiency
Mitochondrial membrane potentialProton gradientReflects coupling efficiency
ATP production assaysEnergy outputFunctional outcome of respiration
Reactive oxygen species (ROS) measurementOxidative stressIndicates electron leakage from the respiratory chain

Studies have shown that knockout or mutation of MT-ND4L significantly reduces complex I levels and basal oxygen consumption rates, indicating its essential role in mitochondrial respiration . When analyzing MT-ND4L mutations, it's crucial to consider heteroplasmy levels, as the phenotypic expression typically occurs when mutation load exceeds a certain threshold .

What computational methods are recommended for predicting the pathogenicity of MT-ND4L variants?

Several computational approaches can be employed to predict the pathogenicity of MT-ND4L variants:

  • MutPred score: This algorithm determines pathogenicity based on protein structure, dynamics, functional residues, amino acid sequence biases, and evolutionary conservation. Scores greater than 0.7 indicate high pathogenicity .

  • Computational structural genomics: This integrates conventional genomics with computational biophysics, biochemistry, and enhanced multi-omics annotation to characterize variants and infer molecular mechanisms for dysfunction .

  • Grantham value assessment: Values greater than 50 indicate drastic physicochemical amino acid changes that may impact protein function .

  • Evolutionary conservation analysis: Highly conserved residues across species are typically crucial for protein function, and mutations in these regions are more likely to be pathogenic .

  • 3D structural analysis: This is superior to sequence-based (2D) annotation methods for predicting the impact of mutations on protein structure and function .

For comprehensive analysis, researchers should combine these computational approaches with functional studies to validate predictions.

How are mutations in MT-ND4L associated with Alzheimer's disease?

Whole exome sequencing analysis of mitochondrial genomes from the Alzheimer's Disease Sequencing Project (ADSP) has revealed a significant association between Alzheimer's disease (AD) and a rare MT-ND4L variant (rs28709356 C>T; minor allele frequency = 0.002; P = 7.3 × 10^-5). Gene-based tests also showed significant association of AD with MT-ND4L (P = 6.71 × 10^-5) .

Changes in MT-ND4L gene expression have long-term consequences on energy metabolism and have been suggested to be a major predisposition factor for neurodegenerative diseases. The exact mechanism by which MT-ND4L variants contribute to AD pathogenesis is still being investigated, but it likely involves disruption of mitochondrial energy production, increased oxidative stress, and impaired neuronal function .

What is the role of MT-ND4L in Leber hereditary optic neuropathy?

A mutation in the MT-ND4L gene has been identified in several families with Leber hereditary optic neuropathy (LHON). This mutation, T10663C (Val65Ala), changes the amino acid valine to alanine at protein position 65 .

While researchers have not definitively determined how this mutation leads to the vision loss characteristic of LHON, it likely disrupts Complex I function, reducing energy production in retinal ganglion cells and optic nerve, which have high energy demands. The specificity of the visual system phenotype, despite the mutation being present in mitochondria throughout the body, remains an active area of research .

How do MT-ND4L variants influence high-altitude adaptation?

Studies of MT-ND4L in Tibetan yaks and cattle have revealed associations between specific haplotypes and high-altitude adaptability. Haplotype Ha1 in MT-ND4L showed positive associations with high-altitude adaptability (p < 0.0017), while haplotype Ha3 negatively associated with this adaptability .

The adaptive mechanisms likely involve modifications in mitochondrial respiration efficiency under hypoxic conditions. As mitochondria are the primary oxygen consumers in cells, optimizing respiration under low oxygen availability is crucial for high-altitude adaptation. MT-ND4L variants may alter the efficiency of electron transport, potentially reducing reactive oxygen species production while maintaining ATP synthesis under hypoxic conditions .

What controls should be included when studying recombinant MT-ND4L function?

When designing experiments to study recombinant MT-ND4L function, consider including these essential controls:

  • Wild-type controls: Include wild-type MT-ND4L protein to establish baseline function.

  • Negative controls: Use buffers without protein or with irrelevant proteins of similar size.

  • Known mutant controls: Include MT-ND4L with well-characterized mutations (e.g., T10663C) as functional reference points.

  • Substrate specificity controls: Test the specificity of MT-ND4L for NADH versus other potential substrates.

  • Inhibitor controls: Include known Complex I inhibitors (e.g., rotenone) to validate specific activity.

  • Heteroplasmy controls: When studying mutations, create controls with different heteroplasmy levels to establish threshold effects.

  • Tissue-specific controls: Since MT-ND4L function may vary by tissue type, include tissue-specific controls when relevant .

How can researchers effectively isolate and purify functional MT-ND4L for in vitro studies?

Isolating functional MT-ND4L is challenging due to its hydrophobicity and membrane integration. A multi-step approach is recommended:

  • Expression system selection: For recombinant expression, consider using systems that can handle membrane proteins, such as specialized E. coli strains with membrane protein expression capabilities.

  • Solubilization optimization: Use mild detergents (e.g., digitonin, n-dodecyl-β-D-maltoside) to extract MT-ND4L while preserving native conformation.

  • Affinity chromatography: Utilize fusion tags (His, GST, or FLAG) for initial purification.

  • Size exclusion chromatography: Remove aggregates and isolate properly folded protein.

  • Functional validation: Assess NADH oxidation activity to confirm proper folding and function.

  • Reconstitution: For functional studies, consider reconstituting the purified protein into liposomes or nanodiscs to mimic the native membrane environment .

When working with Vombatus ursinus MT-ND4L specifically, optimization of these protocols may be necessary due to species-specific properties of the protein.

What are the challenges in studying MT-ND4L interactions with other Complex I subunits?

Investigating MT-ND4L interactions with other Complex I components presents several challenges:

  • Structural complexity: Complex I contains approximately 45 subunits, making isolation of specific interactions difficult.

  • Membrane environment: The hydrophobic nature of MT-ND4L and many other Complex I subunits requires specialized techniques to maintain native conformations.

  • Dynamic interactions: Subunit interactions may change during the catalytic cycle, requiring time-resolved methods.

  • Species-specific variations: Interactions observed in model organisms may differ from those in Vombatus ursinus.

Researchers have overcome these challenges using approaches such as:

  • Crosslinking mass spectrometry to capture transient interactions

  • Cryo-electron microscopy to visualize the complete complex structure

  • Blue native PAGE combined with antibody detection to identify subcomplexes

  • Computational structural genomics to predict interaction interfaces

Studies have shown that MT-ND4L absence prevents the assembly of the entire Complex I, indicating its critical role in the complex's structural integrity .

How does MT-ND4L influence the metabolic profile in cells?

Genome-wide association studies with metabolomics have revealed significant associations between MT-ND4L variants and metabolite concentrations. The variant mt10689 G>A, located in the MT-ND4L gene, has been associated with multiple metabolite ratios, particularly those involving phosphatidylcholine (PC) diacyl C36:6 (PC aa C36:6) .

Changes in MT-ND4L expression have long-term consequences on energy metabolism through several mechanisms:

  • NADH/NAD+ ratio alteration: MT-ND4L dysfunction affects NADH oxidation, disrupting cellular redox balance.

  • Glycerophospholipid metabolism: MT-ND4L variants are associated with changes in phosphatidylcholine levels, suggesting impacts on membrane composition and signaling.

  • Mitochondrial membrane potential: MT-ND4L is crucial for proton pumping during electron transport, affecting mitochondrial membrane potential and subsequent ATP production.

  • Reactive oxygen species generation: Dysfunction in MT-ND4L can increase electron leakage, leading to elevated ROS production .

These metabolic alterations may contribute to the pathogenesis of complex diseases, including neurological disorders and metabolic conditions.

What genomic approaches are most effective for studying MT-ND4L sequence variations?

Several genomic approaches have proven effective for analyzing MT-ND4L variations:

ApproachApplicationResolutionAdvantages
Whole exome sequencingComprehensive mtDNA variant discoverySingle nucleotideCaptures entire mtDNA, allows heteroplasmy detection
Long-range PCRTargeted amplification of mtDNA regionsGene/region-specificReduces nuclear pseudogene contamination
Base editingFunctional validation of variantsSingle nucleotideEnables precise introduction of specific mutations
RNA interferenceGene expression knockdownGene-specificAllows study of loss-of-function phenotypes
Next-generation sequencingDeep coverage analysisSingle nucleotideHigh sensitivity for low-level heteroplasmy detection

For comprehensive analysis, researchers have developed specialized pipelines for accurate assembly and variant calling in mitochondrial genomes embedded within whole exome sequences. This approach has been successfully applied in studies such as the Alzheimer's Disease Sequencing Project, which analyzed 4,220 mtDNA variants across 10,831 participants .

When analyzing MT-ND4L variants, it's essential to consider heteroplasmy levels, as the phenotypic expression typically occurs when mutation load exceeds a threshold specific to the tissue and mutation type.

How do interspecies differences in MT-ND4L contribute to evolutionary adaptation?

Interspecies differences in MT-ND4L reflect evolutionary adaptations to varying environmental conditions and energy demands:

  • High-altitude adaptation: Studies comparing Tibetan yaks, Tibetan cattle, and Holstein-Friesian cattle have identified specific MT-ND4L haplotypes (Ha1) associated with high-altitude adaptability, suggesting selective pressure on mitochondrial function in hypoxic environments .

  • Nuclear-to-mitochondrial gene transfer: In some species like Chlamydomonas reinhardtii, MT-ND4L is encoded in the nuclear genome rather than the mitochondrial genome. This transfer has resulted in modifications that facilitate expression and proper import of the protein into mitochondria, including decreased hydrophobicity compared to mitochondrion-encoded counterparts .

  • Sequence conservation: Despite evolutionary divergence, certain amino acid residues in MT-ND4L remain highly conserved across species, indicating their critical functional importance for Complex I activity .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.