Recombinant Vulpes corsac Cytochrome c oxidase subunit 2 (MT-CO2)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. Please specify your desired tag type for prioritized development.
Synonyms
MT-CO2; COII; COX2; COXII; MTCO2; Cytochrome c oxidase subunit 2; Cytochrome c oxidase polypeptide II
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-227
Protein Length
full length protein
Species
Vulpes corsac (Corsac fox)
Target Names
Target Protein Sequence
MAYPFQLGLXDATSPIMEELLHFHDHTLMIVFLISSLVLYIITLMLTTKLTHTSTMDAQE VETVWTILPAIILILIALPSLRILYMMDEINNPSLTVKTMGHQWYWSYEYTDYEDLNFDS YMIPTQELKPGELRLLEVDNRVVLPMEMTVRMLISSEDVLHSWAVPSLGLKTDAIPGRLN QTTLMAMRPGLYYGQCSEICGSNHSFMPIVLEMVPLSYFETWSAVMV
Uniprot No.

Target Background

Function
Cytochrome c oxidase subunit 2 (MT-CO2) is a component of cytochrome c oxidase (complex IV, CIV), the terminal enzyme in the mitochondrial electron transport chain. This enzyme drives oxidative phosphorylation by cooperating with succinate dehydrogenase (complex II, CII) and ubiquinol-cytochrome c oxidoreductase (complex III, CIII) to transfer electrons from NADH and succinate to molecular oxygen. This process generates an electrochemical gradient across the inner mitochondrial membrane, powering transmembrane transport and ATP synthase. Cytochrome c oxidase catalyzes the reduction of oxygen to water. Electrons from reduced cytochrome c in the intermembrane space are transferred through the copper A center (CuA) of subunit 2 and heme A of subunit 1 to the binuclear center (BNC) in subunit 1, composed of heme A3 and copper B (CuB). The BNC utilizes four electrons from cytochrome c and four protons from the mitochondrial matrix to reduce molecular oxygen to two water molecules.
Protein Families
Cytochrome c oxidase subunit 2 family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is Vulpes corsac Cytochrome c oxidase subunit 2 and its role in mitochondrial function?

Vulpes corsac (corsac fox) Cytochrome c oxidase subunit 2 (MT-CO2) is a mitochondrially-encoded core subunit of cytochrome c oxidase (Complex IV). As part of the terminal enzyme in the electron transport chain, it plays a crucial role in cellular respiration. Complex IV comprises 14 structural subunits of dual genetic origin, with three core subunits (including MT-CO2) encoded by mitochondrial DNA and the remaining 11 subunits encoded by nuclear DNA .

The primary function of cytochrome c oxidase is to transfer electrons from cytochrome c to molecular oxygen, generating water in the process and contributing to the proton gradient necessary for ATP synthesis. MT-CO2 specifically contains critical binding sites for cytochrome c and contributes to the electron transfer pathway within the complex.

How does the recombinant form of Vulpes corsac MT-CO2 compare to its native counterpart?

Recombinant Vulpes corsac MT-CO2 is produced through heterologous expression systems, typically in bacterial hosts, rather than being isolated from corsac fox tissue. While the primary sequence is identical to the native protein, several functional differences may exist:

  • Post-translational modifications present in native MT-CO2 may be absent in recombinant forms

  • Protein folding might differ slightly, affecting tertiary structure

  • Enzymatic activity can vary between recombinant and native proteins

Research by Richter et al. has demonstrated differences between true wild-type cytochrome c oxidase and recombinant wild-type variants, particularly in secondary catalytic activities like catalase function . The recombinant wild-type showed unexpectedly different catalase activity compared to the ATCC wild-type, possibly due to subtle structural differences at the active center .

What evolutionary insights can be gained from studying Vulpes corsac MT-CO2?

The study of Vulpes corsac MT-CO2 provides valuable evolutionary insights into the conservation and adaptation of mitochondrial respiratory proteins across mammalian species. Comparative analysis of MT-CO2 sequences can reveal:

  • Conservation of functional domains across canids and other mammals

  • Species-specific adaptations related to metabolic demands

  • Evolutionary pressures on mitochondrial genes

These insights help researchers understand how different environmental adaptations may have shaped the evolution of energy metabolism in various mammalian lineages, particularly in species like the corsac fox that inhabit harsh environments with fluctuating energy demands.

What expression systems are most effective for producing functional recombinant Vulpes corsac MT-CO2?

Several expression systems can be employed for recombinant MT-CO2 production, each with distinct advantages:

Expression SystemAdvantagesLimitationsTypical Yield
E. coliFast growth, high yield, low costLimited post-translational modifications, inclusion body formation10-50 mg/L
Yeast (P. pastoris)Eukaryotic processing, high yieldLonger production time5-20 mg/L
Insect cellsMammalian-like modificationsHigher cost, complex media1-10 mg/L
Mammalian cellsMost native-like processingHighest cost, lowest yield0.5-5 mg/L

For optimal expression in bacterial systems, research has shown that using low-copy number plasmids under control of native promoters (like the cta-operon promoter P1 used for cytochrome c oxidase) can lead to more properly folded and functional protein . Co-expression with chaperones has been demonstrated to improve folding and reduce catalase activity differences between recombinant and native forms of cytochrome c oxidase .

What purification strategies maintain the integrity of recombinant Vulpes corsac MT-CO2?

Purification of recombinant MT-CO2 requires careful consideration of the protein's hydrophobic nature and incorporation of cofactors. A recommended purification protocol includes:

  • Cell lysis using gentle detergents (e.g., n-dodecyl β-D-maltoside)

  • Initial capture using immobilized metal affinity chromatography (if His-tagged)

  • Ion exchange chromatography for increased purity

  • Size exclusion chromatography as a final polishing step

Throughout purification, maintaining the integrity of MT-CO2 requires careful temperature control (typically 4°C), avoiding harsh pH conditions, and including stabilizing agents like glycerol in buffers. Differential scanning calorimetry (DSC) can be used to assess protein stability, as demonstrated in studies of cytochrome c oxidase that revealed transition midpoint temperatures around 67°C for subunits I and II, with changes upon reduction .

What assays can accurately measure the enzymatic activity of recombinant Vulpes corsac MT-CO2?

Several complementary assays can be employed to characterize the activity of recombinant MT-CO2:

  • Oxygen consumption assay: Measures the primary function of cytochrome c oxidase using oxygen electrodes or optical sensors to track oxygen reduction rates.

  • Cytochrome c oxidation assay: Monitors the oxidation of reduced cytochrome c spectrophotometrically at 550 nm.

  • Hydrogen peroxide metabolism assays: Assesses secondary catalytic activities:

    • Peroxidase activity: Measures the reduction of hydrogen peroxide in the presence of cytochrome c

    • Catalase activity: Measures the dismutation of hydrogen peroxide with typical turnover numbers around 100 min⁻¹

For catalase activity specifically, researchers have observed second-order rate constants ranging from 63.2 M⁻¹s⁻¹ for bovine enzyme to 1200 M⁻¹s⁻¹ for bacterial enzymes, highlighting species-specific variations .

How should researchers address data variability when working with recombinant Vulpes corsac MT-CO2?

Data variability is common when working with recombinant membrane proteins like MT-CO2. To address this:

  • Statistical approaches: Implement robust statistical methods including:

    • Minimum of three biological replicates and multiple technical replicates

    • Appropriate statistical tests (ANOVA, t-tests) with correction for multiple comparisons

    • Non-parametric tests when data doesn't meet normality assumptions

  • Normalization strategies:

    • Normalize activity to protein concentration using Bradford or BCA assays

    • Consider activity ratios between different functions rather than absolute values

    • Use internal standards when comparing different protein preparations

  • Quality control metrics:

    • Consistent spectral properties (A280/A420 ratio)

    • Homogeneity assessment via native PAGE

    • Thermal stability profiles using differential scanning calorimetry

Researchers should be particularly vigilant about subtle differences between recombinant and native proteins, as studies have shown unexpected functional differences in cytochrome c oxidase forms that may impact experimental results .

What considerations are important when comparing recombinant Vulpes corsac MT-CO2 to other species' cytochrome c oxidase?

Cross-species comparisons require careful consideration of several factors:

  • Sequence homology analysis: Align sequences to identify conserved and variable regions that may impact function

  • Structural considerations:

    • Differences in post-translational modifications

    • Species-specific interaction partners

    • Potential variations in metal coordination sites

  • Functional parameters to compare:

    • Oxygen affinity (reported Km values range from 40 nM for high-affinity oxidases to 800 nM for low-affinity enzymes)

    • Electron transfer rates

    • Alternative catalytic activities

  • Evolutionary context:

    • Consider the environmental adaptations of source species

    • Account for metabolic specializations

When interpreting comparative data, researchers should consider that cbb3-type cytochrome c oxidases represent a distinct bacterial lineage with high oxygen affinity (Km = 40 nM) compared to other forms, highlighting the diversity of these enzymes across species .

How can recombinant Vulpes corsac MT-CO2 contribute to structural studies of complex IV?

Recombinant Vulpes corsac MT-CO2 can provide valuable insights into the structural organization of mammalian complex IV through several approaches:

  • X-ray crystallography and cryo-EM studies:

    • Recombinant protein can be used for co-crystallization with other subunits

    • Structure determination can reveal species-specific features

    • Comparison with existing structures can highlight unique aspects of canid cytochrome c oxidase

  • Protein-protein interaction mapping:

    • Cross-linking mass spectrometry to identify interaction interfaces

    • Co-immunoprecipitation to validate binding partners

    • Surface plasmon resonance to determine binding kinetics

  • Functional domain analysis:

    • Site-directed mutagenesis to probe critical residues

    • Chimeric constructs combining domains from different species

These structural insights complement the growing number of structural snapshots of cytochrome c oxidase and related macromolecular complexes like the mitoribosome, advancing our understanding of complex IV assembly and function .

What role might Vulpes corsac MT-CO2 play in understanding mitochondrial translation regulation?

Research on MT-CO2 can provide insights into the coordination between mitochondrial and nuclear gene expression, particularly relevant to complex IV assembly:

  • Translation regulation mechanisms:

    • Studying how MT-CO2 synthesis is coordinated with nuclear-encoded subunits

    • Investigating regulatory factors similar to MITRAC (mitochondrial translation regulation assembly intermediate of cytochrome c oxidase)

    • Understanding feedback mechanisms that balance subunit production

  • Assembly pathway analysis:

    • Tracing the incorporation of MT-CO2 into complex IV intermediates

    • Identifying assembly factors that interact specifically with MT-CO2

    • Mapping the sequence of assembly events

This research connects with emerging understanding of the link between mitochondrial translation regulation and complex IV assembly, as recent studies have revealed proteins involved in both processes .

What are common issues in recombinant MT-CO2 expression and how can they be resolved?

Researchers frequently encounter several challenges when working with recombinant MT-CO2:

ChallengeCauseSolution
Low expression yieldToxicity to host cells, inefficient translationUse low-copy number plasmids, optimize codon usage, control induction conditions
Inclusion body formationImproper folding, hydrophobic aggregationLower induction temperature, co-express with chaperones, use fusion tags
Reduced activityImproper cofactor incorporationSupplement growth media with heme precursors, optimize metal ion availability
Stability issuesDetergent sensitivity, proteolytic degradationScreen multiple detergents, include protease inhibitors, optimize buffer conditions

Research has shown that co-expression with chaperone proteins can significantly improve the functionality of recombinant cytochrome c oxidase proteins by ensuring proper folding and cofactor insertion . Additionally, using the appropriate expression system with a controlled copy number of the expression plasmid can help reduce the probability of side reactions like increased catalase activity .

How can researchers differentiate between true functional differences and artifacts when studying recombinant Vulpes corsac MT-CO2?

Distinguishing genuine functional differences from artifacts requires systematic controls and validation:

  • Multiple preparation methods:

    • Compare different expression systems

    • Evaluate native versus recombinant protein when possible

    • Test different purification strategies

  • Comprehensive activity profiling:

    • Measure multiple enzymatic activities (primary and secondary)

    • Determine kinetic parameters under various conditions

    • Compare activity ratios rather than absolute values

  • Structural validation:

    • Use differential scanning calorimetry to compare thermal stability profiles

    • Employ circular dichroism to assess secondary structure

    • Utilize limited proteolysis to probe structural differences

Studies have demonstrated unexpected differences between true wild-type and recombinant wild-type cytochrome c oxidase, particularly in catalase activity, highlighting the importance of careful validation . These differences have been attributed to potential excess of plasmid-encoded subunit I and shortage of genome-encoded chaperones leading to inaccurate cofactor insertion .

How might Vulpes corsac MT-CO2 research contribute to understanding mitochondrial diseases?

Research on Vulpes corsac MT-CO2 can advance our understanding of mitochondrial diseases through:

The dual genetic origin of complex IV components, with MT-CO2 being mitochondrially encoded while other subunits are nuclear-encoded, makes this research particularly relevant to understanding diseases caused by the disruption of coordinated gene expression .

What emerging technologies are most promising for advancing Vulpes corsac MT-CO2 research?

Several cutting-edge technologies show promise for advancing MT-CO2 research:

  • Cryo-electron microscopy:

    • Enables visualization of complex IV structure at near-atomic resolution

    • Allows study of conformational changes during catalytic cycle

    • Can reveal species-specific structural features

  • Genome editing technologies:

    • CRISPR/Cas9 for creating cellular models with modified MT-CO2

    • Base editing for introducing specific mutations

    • Prime editing for precise sequence modifications

  • Advanced biophysical techniques:

    • Single-molecule FRET to study dynamic structural changes

    • Nanodiscs for studying membrane proteins in native-like environments

    • Hydrogen-deuterium exchange mass spectrometry for mapping protein dynamics

  • Computational approaches:

    • Molecular dynamics simulations to predict functional impacts of mutations

    • Machine learning for identifying patterns in sequence-function relationships

    • Systems biology models integrating respiratory complex functions

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.