Recombinant Vulpes vulpes 5-hydroxytryptamine receptor 1B (HTR1B)

What is HTR1B and what are its alternative designations?

HTR1B (5-hydroxytryptamine receptor 1B) is a serotonin receptor protein found in Vulpes vulpes (red fox). It is also known by several alternative designations including 5-HT-1B, 5-HT1B, 5-HTR1B, and Serotonin receptor 1B. This receptor belongs to the broader family of 5-HT receptors that are widely distributed across Metazoa and plays critical roles in neurological signaling pathways .

What is the molecular structure of Vulpes vulpes HTR1B?

The recombinant Vulpes vulpes HTR1B is characterized by a specific amino acid sequence that defines its structure and function. The complete sequence begins with MEDAGTPCAPPPPAGSQTGAPPANLSSAPHNCSAEGYIYQDSIALPWK and continues through the full protein sequence. This protein spans the expression region 1-389 and functions as a transmembrane receptor with characteristic binding domains for serotonin .

How should Recombinant Vulpes vulpes HTR1B be stored for optimal stability?

For optimal stability, Recombinant Vulpes vulpes HTR1B should be stored at -20°C to -80°C. The shelf life depends on the formulation: liquid forms typically remain stable for 6 months, while lyophilized preparations can maintain stability for up to 12 months. Working aliquots can be kept at 4°C for up to one week, but repeated freezing and thawing cycles should be strictly avoided as they compromise protein integrity .

What is the recommended reconstitution protocol for lyophilized HTR1B?

The recommended reconstitution protocol involves:

• Brief centrifugation of the vial before opening to bring contents to the bottom

• Reconstitution in deionized sterile water to achieve a concentration of 0.1-1.0 mg/mL

• Addition of glycerol to a final concentration of 5-50% (with 50% being the standard recommendation)

• Aliquoting for long-term storage at -20°C/-80°C

How conserved is HTR1B across mammalian species?

While the search results don't provide specific conservation data across all mammals, research indicates that serotonin receptors, including HTR1B, have functional homologs across numerous species. The functional importance of HTR1B has been demonstrated in both Vulpes vulpes and mouse models, suggesting evolutionary conservation of this receptor's role in neurological processes. Researchers investigating cross-species comparisons should consider sequence alignment and functional domain analyses when extrapolating findings between species .

How does Vulpes vulpes HTR1B compare functionally to murine HTR1B?

Research in mouse models has demonstrated that HTR1B plays a crucial role in retinal physiology. HTR1B knockout mice exhibit reduced electroretinogram (ERG) amplitudes and optokinetic response thresholds compared to controls, indicating its importance in visual function. The pSTR slope was reduced by 40% (P=0.0035) in knockout mice, while scotopic contrast sensitivity thresholds were diminished by 10%-15% (P=0.0334). Interestingly, despite these functional deficits, retinal morphology and retinal ganglion cell counts remained normal in these models .

What physiological systems are most affected by HTR1B modulation?

Based on the available research, HTR1B appears to have significant roles in:

• Visual systems - particularly retinal function and visual processing

• Neurological systems - as part of the broader serotonergic signaling network

• Behavioral regulation - as 5-HT receptors generally influence various behavioral processes including mobility and sensory processing

The visual system effects are particularly well-documented, with HTR1B expression primarily restricted to the ganglion cell layer (GCL) of the retina in mouse models .

What are the key considerations for designing HTR1B knockout experiments?

When designing HTR1B knockout experiments, researchers should consider:

• Selection of appropriate control groups (wild-type and heterozygous models)

• Comprehensive phenotypic assessment:

  • Functional tests (e.g., electroretinograms, behavioral assessments)

  • Structural analyses (histology, optical coherence tomography)

  • Molecular assessments (expression of compensatory pathways)

• Age and sex-matching of experimental animals

• Environmental standardization to minimize confounding variables

The research on mouse models demonstrates the importance of these considerations, as HTR1B knockout produced functional visual deficits without obvious structural changes, highlighting the need for multiple assessment modalities .

How can researchers effectively validate HTR1B-specific antibodies?

Validation of HTR1B-specific antibodies should follow a multi-step process:

• Western blot analysis comparing wild-type tissue with HTR1B-knockout samples to confirm specificity

• Immunohistochemistry with appropriate positive controls (tissues known to express HTR1B) and negative controls

• Peptide competition assays to verify binding specificity

• Cross-validation with orthogonal techniques such as in situ hybridization (as used in the mouse studies) to correlate protein detection with mRNA expression patterns

What expression systems are most suitable for producing recombinant Vulpes vulpes HTR1B?

Mammalian cell expression systems are the preferred method for producing recombinant Vulpes vulpes HTR1B, as indicated in the product specifications. This choice is likely due to the need for proper post-translational modifications and protein folding that may not be achievable in bacterial or insect cell systems. The mammalian expression system helps ensure that the receptor maintains its native conformation and functional properties .

What electrophysiological methods are most appropriate for studying HTR1B function?

Based on the research with mouse models, several electrophysiological methods have proven valuable for studying HTR1B function:

• Whole field flash electroretinograms (ERGs) for recording scotopic and photopic amplitudes

• Measurement of specific ERG components:

  • Positive scotopic threshold response (pSTR)

  • b-wave amplitude

  • a-wave amplitude

• Analysis of amplitude/light intensity relationships (slope measurements)

These techniques allowed researchers to detect a 40% reduction in pSTR slope in HTR1B knockout mice, providing sensitive indicators of functional changes even in the absence of structural alterations .

How can HTR1B signaling pathways be analyzed in vitro?

For in vitro analysis of HTR1B signaling pathways, researchers should consider:

• Receptor-ligand binding assays using recombinant HTR1B and labeled 5-HT or specific agonists/antagonists

• Second messenger assays (cAMP measurements, calcium flux, etc.) following receptor stimulation

• G-protein coupling experiments to characterize signaling cascade activation

• Receptor internalization and trafficking studies using fluorescently tagged HTR1B

• Pharmacological profiling using selective 5-HT receptor agonists and antagonists

These approaches would help elucidate the specific signaling mechanisms through which HTR1B mediates its effects on cellular physiology .

What behavioral assays are suitable for assessing HTR1B function in animal models?

Drawing from the mouse studies, appropriate behavioral assays for assessing HTR1B function include:

• Optokinetic response (OKR) testing to evaluate:

  • Spatial frequency thresholds

  • Contrast sensitivity thresholds

  • Performance under scotopic (low light) and photopic (bright light) conditions

• Visual discrimination tasks to assess higher-order visual processing

• Light/dark preference tests that may reveal alterations in light sensitivity

• Tests of species-specific behaviors known to involve serotonergic signaling

These behavioral approaches can detect subtle functional changes, as evidenced by the 10-15% reduction in scotopic contrast sensitivity observed in HTR1B knockout mice .

How might HTR1B be involved in retinal disease mechanisms?

The research on HTR1B knockout mice suggests important implications for retinal disease mechanisms:

• Despite normal retinal structure and RGC counts, HTR1B-deficient mice show significant functional deficits, suggesting HTR1B may be involved in:

  • Signal transduction within retinal circuits

  • Modulation of retinal adaptation mechanisms

  • Synaptic transmission efficiency in visual pathways

These findings indicate that HTR1B dysfunction could contribute to functional visual disorders even in the absence of obvious retinal degeneration or structural abnormalities. This has implications for understanding conditions like congenital stationary night blindness or certain forms of retinitis pigmentosa where functional deficits may precede structural changes .

What are the potential cross-interactions between HTR1B and other neurotransmitter systems?

Serotonin receptors, including HTR1B, operate within complex neurochemical networks where cross-interactions with other neurotransmitter systems are common:

• Dopaminergic interactions - serotonergic-dopaminergic balance is crucial in many neural circuits

• GABAergic modulation - inhibitory tone may be regulated in part through serotonergic signaling

• Glutamatergic effects - excitatory transmission can be influenced by 5-HT receptor activation

Research on 5-HT receptors broadly indicates that these cross-system interactions are important in various physiological functions and could represent targets for therapeutic interventions in conditions ranging from migraine to psychosis .

How do post-translational modifications affect HTR1B function?

While specific data on post-translational modifications of Vulpes vulpes HTR1B is not provided in the search results, research on serotonin receptors generally suggests several important modifications that likely apply:

• Glycosylation - affecting receptor trafficking and ligand binding

• Phosphorylation - regulating desensitization and internalization

• Palmitoylation - influencing membrane localization and signaling efficiency

These modifications can significantly alter receptor pharmacology and function, potentially explaining differences in receptor behavior across experimental conditions or biological contexts .

What are the major challenges in maintaining HTR1B stability during experimental procedures?

Based on storage and handling recommendations, key challenges in maintaining HTR1B stability include:

• Protein degradation during freeze-thaw cycles

• Maintaining appropriate buffer conditions

• Preventing aggregation and denaturation

• Preserving functional conformation

Recommended solutions include:

• Storing as single-use aliquots to avoid repeated freezing and thawing

• Adding glycerol (5-50%) as a cryoprotectant

• Using optimized buffer systems (Tris-based buffers are recommended)

• Working with freshly prepared material whenever possible

How can researchers address specificity concerns when working with 5-HT receptor subtypes?

When investigating 5-HT receptor subtypes, specificity challenges can be addressed through:

• Using highly selective pharmacological tools:

  • Subtype-specific agonists and antagonists

  • Radioligand binding with competitive displacement to confirm binding site specificity

• Genetic approaches:

  • Receptor subtype knockout models

  • RNA interference to selectively downregulate specific receptor subtypes

  • Site-directed mutagenesis to identify critical binding residues

• Combinatorial approaches:

  • Correlating pharmacological profiles with genetic manipulation outcomes

  • Using heterologous expression systems with defined receptor subtype expression

What quality control metrics should be applied to recombinant HTR1B preparations?

Key quality control metrics for recombinant HTR1B preparations should include:

• Purity assessment: >85% purity by SDS-PAGE is the standard for commercial preparations

• Functional validation:

  • Ligand binding assays

  • Second messenger response measurements

• Structural integrity verification:

  • Circular dichroism to assess secondary structure

  • Thermal stability assays

• Batch-to-batch consistency testing

• Endotoxin level measurement (particularly important for in vivo applications)

What are the most promising research directions for HTR1B in neuroscience?

Based on the current understanding of HTR1B function, particularly in visual systems, promising research directions include:

• Further characterization of HTR1B's role in retinal circuit function and visual processing

• Investigation of potential therapeutic applications in visual disorders

• Cross-species comparative studies to understand evolutionary conservation and divergence

• Integration of HTR1B signaling with broader neurotransmitter networks

The unexpected finding that HTR1B is crucial for normal retinal function despite no apparent structural requirements suggests complex roles in neural signaling that warrant deeper investigation .

How might comparative studies of HTR1B across species inform evolutionary neurobiology?

Comparative studies of HTR1B across species could provide valuable insights into evolutionary neurobiology by:

• Tracing the phylogenetic history of serotonergic signaling systems

• Identifying conserved functional domains versus species-specific adaptations

• Correlating receptor variations with species-specific behavioral traits

• Understanding how environmental pressures shape neurotransmitter systems

The identification of over 1000 5-HT receptor subunits across Metazoa suggests a rich evolutionary history that could inform our understanding of neural circuit evolution and adaptation .

What therapeutic potentials might arise from better understanding of HTR1B function?

Improved understanding of HTR1B function could lead to therapeutic applications in:

• Visual disorders - particularly those involving retinal signal processing deficits

• Neuropsychiatric conditions - given the broader role of serotonergic signaling in behavior

• Pain management - as 5-HT receptor modulators have shown efficacy in conditions like migraine

• Novel drug development - targeting specific receptor-mediated signaling pathways with reduced side effects

The diverse roles of 5-HT receptors in physiological and pathological processes suggest that selective HTR1B modulators could have therapeutic potential across multiple medical domains .