Recombinant Vulpes vulpes Melanocortin receptor 4 (MC4R)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Vulpes vulpes Melanocortin Receptor 4 (MC4R)

Recombinant Vulpes vulpes Melanocortin Receptor 4 (MC4R) is a laboratory-synthesized version of the melanocortin 4 receptor protein derived from the red fox (Vulpes vulpes). This receptor belongs to the G-protein-coupled receptor (GPCR) family and plays a critical role in energy homeostasis, appetite regulation, and metabolic processes . Produced using E. coli expression systems, the recombinant protein is tagged with histidine (His) for purification and structural studies .

Research Applications

Obesity and Metabolic Studies:

  • MC4R mutations are linked to monogenic obesity in humans and model organisms . Recombinant Vulpes vulpes MC4R enables comparative studies of receptor dysfunction across species .

  • Used to screen small-molecule agonists (e.g., setmelanotide) for obesity therapeutics .

Pharmacological Assays:

  • Functional assays measure cAMP production or ligand-binding affinity to assess receptor activation/inhibition .

  • Structural models (e.g., cryo-EM, NMR) utilize recombinant MC4R to map ligand-binding pockets and allosteric sites .

Expression and Production Data

Sequence Highlights:

  • Extracellular loop 2 (ECL2) is truncated compared to other GPCRs, influencing ligand specificity .

  • Transmembrane helix 5 (TM5) lacks a conserved proline residue, altering helical kinks and ligand docking .

Challenges and Future Directions

  • Limitations: Recombinant MC4R may lack native post-translational modifications present in mammalian cells .

  • Innovations: Co-expression with accessory proteins (e.g., MRAP2) to mimic physiological signaling environments .

  • Therapeutic Potential: Structural insights from recombinant MC4R could enhance design of biased agonists for obesity treatment .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is crucial for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
MC4R; Melanocortin receptor 4; MC4-R
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-332
Protein Length
full length protein
Species
Vulpes vulpes (Red fox)
Target Names
Target Protein Sequence
MNSTLQHGMHTSLHFWNRSTYGQHSNATESLGKGYPDGGCYEQLFVSPEVFVTLGVISLL ENILVIVAIAKNKNLHSPMYFFICSLAVADMLVSVSNGSETIVITLLNSTDTDAQSFTVN IDNVIDSVICSSLLASICSLLSIAVDRYFTIFYALQYHNIMTVRRVGIIISCIWAACTVS GILFIIYSDSTAVIICLITMFFTMLALMASLYVHMFLMARLHIKRIAVLPGTGTIRQGAN MKGAITLTILIGVFVVCWAPFFLHLIFYISCPQNPYCVCFMSHFNLYLILIMCNSIIDPL IYALRSQELRKTFKEIICCYPLGGLCDLSSRY
Uniprot No.

Target Background

Function

Melanocortin receptor 4 (MC4R): A receptor specific to the heptapeptide core common to adrenocorticotropic hormone (ACTH) and α-, β-, and γ-melanocyte-stimulating hormones (MSHs). MC4R plays a critical role in energy homeostasis and somatic growth. Its signaling is mediated by G proteins that stimulate adenylate cyclase, leading to increased cAMP levels.

Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Melanocortin Receptor 4 and what is its primary physiological role?

Melanocortin Receptor 4 (MC4R) is a G protein-coupled receptor (GPCR) that plays a pivotal role in energy homeostasis. It is primarily expressed in the central nervous system, particularly in the hypothalamus, though expression has also been detected in various peripheral tissues including limb tissues during development . MC4R functions through binding of Pro-opiomelanocortin (POMC)-derived peptides such as α-/β-melanocyte-stimulating hormone (MSH), which activates G proteins (primarily Gαs), leading to downstream signaling cascades that regulate energy balance . A single copy of a loss-of-function MC4R allele is sufficient to cause severe obesity in both rodents and humans, highlighting its critical role in metabolic regulation .

How does the structure of Vulpes vulpes MC4R compare to human and other mammalian MC4R proteins?

While the provided search results don't specifically address Vulpes vulpes MC4R structure, research in melanocortin biology has benefited significantly from the determination of the 3D structure of MC4R in 2020, which represents a major milestone for understanding this receptor's function . MC4R structure analysis reveals that mutations affecting plasma membrane expression tend to be enriched in transmembrane domains 1 and 4 (TM-1 and TM-4), suggesting these regions are critical for proper protein folding . Mutations that don't affect expression but alter function often map to either the N-terminal segment (affecting ligand binding) or to regions classically involved in receptor activation and coupling to signaling transducers, such as TM-5, TM-6, TM-7, and the C-terminus . This structural knowledge can inform comparative studies between species, including Vulpes vulpes MC4R.

What are the major signaling pathways activated by MC4R stimulation?

MC4R signaling primarily occurs through two major pathways:

  • Gαs coupling pathway: Activation of MC4R leads to Gαs protein coupling, which stimulates adenylyl cyclase to increase intracellular cAMP levels and activate protein kinase A (PKA) .

  • β-arrestin pathway: Upon ligand stimulation, MC4R undergoes β-arrestin-mediated internalization, with β-arrestin-2 playing a particularly important role in agonist-dependent internalization . β-arrestins not only facilitate receptor internalization but also initiate β-arrestin-dependent activation of the MAPK pathway, leading to phosphorylation of ERK1/2 .

These pathways work in concert, as evidenced by experiments showing that inhibition of dynamin-dependent internalization markedly reduces agonist-induced cAMP generation and completely abolishes ERK1/2 phosphorylation . Similarly, knockdown of genes encoding Gαs reduces cAMP production and completely inhibits ERK1/2 phosphorylation . These findings indicate that activation of ERK1/2 downstream of MC4R is modulated by both β-arrestin and Gαs-coupled pathways .

What expression systems are most effective for producing recombinant MC4R for structural and functional studies?

Based on current research methodologies, HEK293 cells that do not endogenously express MC4R have proven to be an effective expression system for recombinant MC4R studies . This cell line allows for transient transfection with wild-type or mutant forms of MC4R, enabling researchers to study various aspects of receptor function including trafficking, signaling, and protein-protein interactions . For structural studies, approaches that have been successful with other GPCRs, such as insect cell expression systems or stable mammalian cell lines, may also be applicable for MC4R expression, though specific optimization for Vulpes vulpes MC4R may be necessary.

When establishing an expression system, it's important to consider:

  • Expression levels and proper folding of the receptor

  • Post-translational modifications that may affect function

  • The cellular environment that supports appropriate trafficking and signaling

What methodologies are most appropriate for studying MC4R trafficking and internalization?

Several complementary methodologies have proven effective for studying MC4R trafficking and internalization:

  • Bioluminescence Resonance Energy Transfer (BRET) assays: By using MC4R fusion constructs with sensors that localize to specific cellular compartments (plasma membrane, early endosomes, late endosomes/lysosomes), researchers can quantify agonist-induced changes in MC4R expression in these compartments . This approach allows for real-time monitoring of receptor trafficking.

  • Enzyme-linked immunosorbent assay (ELISA): This method can be used to quantify cell surface expression of MC4R .

  • Radiolabeled ligand binding assays: These assays provide information about receptor density at the cell surface .

  • NanoBiT protein:protein interaction assay: This technique is valuable for studying interactions between MC4R and signaling partners such as β-arrestins .

  • Immunofluorescence staining: This approach allows visualization of MC4R localization within cells and tissues .

Each method offers distinct advantages, and combining multiple approaches provides more robust data regarding MC4R trafficking dynamics.

How can researchers effectively measure MC4R-mediated signaling responses?

To comprehensively assess MC4R-mediated signaling responses, researchers should employ multiple complementary assays that target different aspects of the signaling cascade:

  • cAMP accumulation assays: Methods such as the pGloSensor-20F assay can measure agonist-induced cAMP production as a readout of Gαs activation .

  • G protein coupling assays: Enzyme complementation assays can directly measure coupling between MC4R and Gαs, providing information about the initial step in signaling .

  • ERK1/2 phosphorylation assays: Western blotting for phosphorylated ERK1/2 provides a measure of MAPK pathway activation downstream of MC4R .

  • β-arrestin recruitment assays: BRET-based approaches can quantify agonist-induced recruitment of β-arrestin-1 and β-arrestin-2 to MC4R .

It's important to note that signal amplification in secondary messenger assays (such as cAMP accumulation) may mask partial loss-of-function in G protein coupling. Therefore, assays that directly measure receptor occupancy-related signals (β-arrestin recruitment or Gαs coupling) are more sensitive for detecting subtle functional differences between wild-type and mutant receptors .

What is the role of MC4R signaling in limb regeneration, and how can it be experimentally manipulated?

Research has demonstrated that MC4R signaling plays a critical role in vertebrate limb regeneration. In Xenopus tadpoles, MC4R is expressed both in unamputated limb buds and in limb regenerates, specifically in the blastema and epidermis . Functional studies show that MC4R signaling is required for limb regeneration in regeneration-competent tadpoles and can stimulate limb regeneration in later-stage regeneration-defective tadpoles .

MC4R signaling in limb regeneration can be experimentally manipulated through several approaches:

  • Morpholino antisense oligonucleotides: Researchers have successfully designed morpholinos targeting MC4R to reduce its expression levels in tadpole limbs .

  • α-MSH administration: As an MC4R agonist, α-MSH can be administered to stimulate MC4R signaling .

  • Hypothalamus injury models: Injury to the hypothalamus causes regeneration defects in Xenopus tadpole limbs, with reduced MC4R expression, providing a model to study the relationship between central and peripheral MC4R signaling .

These manipulations have revealed that MC4R regulates limb regeneration through modulating energy homeostasis and reactive oxygen species (ROS) production . Additionally, α-MSH/MC4R signaling can substitute for the effect of innervation on limb regeneration, suggesting an important relationship between neuronal inputs and MC4R function in regenerating tissues .

How do MC4R knockout or mutation models inform our understanding of receptor function?

MC4R knockout or mutation models have provided critical insights into receptor function across multiple physiological systems:

In metabolic regulation, heterozygous mutations in MC4R that impair cAMP production represent the commonest monogenic form of obesity in humans . Carriers of MC4R mutations display characteristic features including severe early-onset obesity, accelerated linear growth, early hyperinsulinemia, and low systolic blood pressure .

Beyond metabolic phenotypes, MC4R mutations have been linked to cardiovascular conditions, with evidence that MC4R mutation causes dilated cardiomyopathy in mice , suggesting broader functions for this receptor than previously appreciated.

In regenerative contexts, studies show that MC4R signaling is required for both Xenopus limb regeneration and mouse digit regeneration, linking this receptor to tissue repair mechanisms .

How do obesity-associated versus obesity-protecting MC4R variants differ in their trafficking and signaling mechanisms?

Research has revealed distinct trafficking and signaling mechanisms that differentiate obesity-associated from obesity-protecting MC4R variants:

Obesity-associated MC4R variants:

  • Most obesity-associated mutations impair trafficking to the plasma membrane

  • Variants with normal cell surface expression often show defects in agonist-induced internalization, with 10 variants reducing trafficking away from the plasma membrane, and others affecting trafficking to early endosomes

  • Many variants impair coupling to Gαs and/or recruitment of β-arrestins, even when they don't affect cAMP accumulation in standard assays

  • Some mutations disrupt MC4R homodimerization, which may contribute to their deleterious effects

Obesity-protecting MC4R variants (specifically V103I and I251L):

  • Show increased presence at the plasma membrane

  • V103I exhibits normal agonist-induced internalization but accelerated recycling to the plasma membrane

  • I251L shows reduced agonist-induced internalization

  • Both variants display reduced expression in late endosomes/lysosomes

  • The increased plasma membrane expression of these mutants leads to enhanced exposure to extracellular ligands and increased intracellular signaling (gain of function)

These differences in trafficking dynamics explain why V103I and I251L variants are associated with substantial reductions in the risk of obesity and type 2 diabetes in human populations .

What are the critical molecular determinants for ligand specificity in MC4R compared to other melanocortin receptors?

The determination of the MC4R 3D structure in complex with the melanocortin antagonist SHU9119 has provided valuable insights into ligand binding specificity . While the search results don't provide exhaustive information on species-specific ligand binding determinants for Vulpes vulpes MC4R, structural mapping of human MC4R variants affecting signaling has revealed important insights:

  • Mutations in the N-terminal segment often affect ligand binding

  • Mutations in receptor segments related to activation and coupling to signaling transducers (such as TM-5, TM-6, TM-7, and the C-terminus) affect downstream signaling without necessarily altering ligand binding

The specific residues involved in these interactions likely include conserved "microswitches" that determine different receptor activation and coupling states . For a comprehensive understanding of ligand specificity in Vulpes vulpes MC4R, directed mutagenesis studies comparing binding affinities of various melanocortin peptides and synthetic ligands would be required.

How does MC4R homodimerization affect receptor function, and what experimental approaches can detect these interactions?

Research indicates that MC4R can form homodimers, and this dimerization plays a functional role in receptor signaling:

  • Structural mapping reveals specific residues involved in MC4R homodimerization

  • Multiple obesity-associated mutations disrupt this homodimerization process

  • The disruption of dimerization may contribute to the pathogenic effects of these mutations in obesity

To detect and study MC4R homodimerization, several experimental approaches can be employed:

  • Resonance energy transfer techniques: Both BRET and FRET (Fluorescence Resonance Energy Transfer) can detect protein-protein interactions in living cells when receptor molecules are appropriately tagged with energy donor and acceptor molecules.

  • Cross-linking studies: Chemical cross-linking followed by immunoprecipitation and Western blotting can identify receptor dimers.

  • Co-immunoprecipitation: When receptors are tagged with different epitopes, co-immunoprecipitation can provide evidence of interaction.

  • Proximity ligation assays: These provide sensitive detection of protein interactions in fixed cells and tissues.

Understanding the functional consequences of MC4R homodimerization could provide new avenues for therapeutic development, particularly if certain ligands selectively affect monomeric versus dimeric receptor populations.

How can sequence variations in MC4R across species inform our understanding of metabolic adaptation?

Comparative analysis of MC4R across species can provide valuable insights into metabolic adaptation throughout evolution. While the search results don't specifically address cross-species variations in MC4R, the functional importance of specific regions identified in human and rodent studies suggests key areas for comparative analysis:

  • Transmembrane domains TM-1 and TM-4 are critical for proper protein folding and trafficking

  • The N-terminal segment is important for ligand binding specificity

  • Regions in TM-5, TM-6, TM-7, and the C-terminus are involved in receptor activation and signaling

By comparing sequence conservation and variation in these regions across species with different metabolic adaptations (including Vulpes vulpes), researchers can identify:

  • Conserved residues likely critical for fundamental MC4R function

  • Variable regions that might contribute to species-specific metabolic adaptations

  • Correlations between MC4R sequence variations and physiological adaptations to different environments and diets

This comparative approach could be particularly informative for understanding how MC4R function may be adapted in species like the red fox (Vulpes vulpes) that experience seasonal variations in food availability and energy requirements.

What are the differences in MC4R expression patterns across tissues in Vulpes vulpes compared to other mammals?

While the provided search results don't specifically address Vulpes vulpes MC4R expression patterns, they provide context for expected expression patterns based on other species:

  • MC4R is heavily expressed in the central nervous system, particularly in the hypothalamus

  • MC4R expression has been detected in peripheral tissues, including in embryonic limbs in rats

  • In Xenopus, MC4R is expressed in limb buds and regenerating limbs, specifically in the blastema and epidermis

  • MC4R expression has been reported in enteroendocrine L cells

To characterize MC4R expression in Vulpes vulpes specifically, researchers would need to employ techniques such as:

  • Quantitative PCR to measure transcript levels in different tissues

  • In situ hybridization to localize expression within specific tissue structures

  • Immunohistochemistry using validated MC4R antibodies

  • Single-cell RNA sequencing to identify specific cell populations expressing MC4R

Understanding species-specific expression patterns could provide insights into potential functional adaptations of MC4R signaling in red foxes compared to other mammals.

How might research on recombinant Vulpes vulpes MC4R inform development of more selective MC4R ligands?

Research on recombinant Vulpes vulpes MC4R could contribute significantly to the development of selective MC4R ligands through comparative pharmacology approaches:

  • Species differences in ligand binding sites and activation mechanisms can reveal critical determinants of ligand selectivity and efficacy

  • The 3D structure of MC4R provides a template for structure-based drug discovery, with multiple potentially druggable sites accessible at the cell surface

  • Comparing the binding profiles of natural and synthetic ligands across species variants of MC4R can identify conserved and divergent binding determinants

  • Testing compounds across species variants can help identify ligands with improved selectivity for specific signaling pathways (biased ligands)

The development of more selective MC4R ligands is particularly important given that MC4R represents a major target for weight loss therapy . Understanding the specific structural features of Vulpes vulpes MC4R that differ from human MC4R could potentially identify novel binding determinants that could be exploited for therapeutic development.

What is the relationship between MC4R signaling and cellular energy metabolism, and how can it be experimentally measured?

MC4R signaling plays a crucial role in regulating cellular energy metabolism, with implications for both systemic energy balance and local tissue metabolism:

  • Research has established a link between MC4R signaling, energy homeostasis, and reactive oxygen species (ROS) production in regenerating tissues

  • MC4R signaling regulates energy metabolism in limb blastema cells during regeneration

  • Hypothalamus injury, which affects central melanocortin signaling, leads to reduced α-MSH levels and decreased MC4R expression in limb tissues, affecting their regenerative capacity

To experimentally measure the effects of MC4R signaling on cellular energy metabolism, researchers can employ:

  • Metabolic flux analysis: Measuring oxygen consumption rate and extracellular acidification rate to assess mitochondrial respiration and glycolysis

  • ROS detection assays: Using fluorescent probes to measure intracellular ROS levels

  • ATP quantification: Assessing cellular energy status

  • Metabolomic profiling: Characterizing changes in metabolic intermediates

  • Gene expression analysis: Measuring transcriptional changes in metabolic enzymes

  • Protein phosphorylation studies: Assessing activation of energy-sensing pathways like AMPK

Understanding how MC4R signaling affects cellular energy metabolism provides new avenues for exploring its functions beyond traditional neuroendocrine pathways, potentially explaining its diverse physiological roles in different tissues.

Table 1: Key MC4R Mutations and Their Functional Effects

MC4R VariantClassificationEffect on PM ExpressionEffect on InternalizationEffect on Gαs CouplingEffect on cAMP ProductionEffect on β-arrestin RecruitmentPhenotypic Association
Wild-typeReferenceNormalNormalNormalNormalNormalN/A
V103IObesity-protectingIncreasedNormalNot specifiedNot specifiedNot specifiedReduced obesity risk
I251LObesity-protectingIncreasedReducedNot specifiedNot specifiedNot specifiedReduced obesity risk
Various obesity-associated mutationsPathogenicMost reducedMost reducedMany reducedSome reducedMany reducedSevere obesity
"WT-like" obesity-associated mutationsPreviously considered non-pathogenicNormalMany affectedMany reducedMost normalMany reducedFeatures of MC4R deficiency

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.