Recombinant Walleye dermal sarcoma virus Envelope glycoprotein (env)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we will prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
env; Envelope glycoprotein; Env polyprotein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
469-1160
Protein Length
Full Length of Mature Protein
Species
Walleye dermal sarcoma virus (WDSV)
Target Names
env
Target Protein Sequence
DLGIGLHSTLNSWWNGANSLGLTVESADRQKYDQKILKVLQNLAVQQRTDVKNQQTLGKA LETPIYTITLQLADSLTAAILKHEQQQNVGITCKDIAILTVTQIATYLRDIQHEHLPVWF IEQITNQILLPVGQVIMPEITAPPILNPLIGWNQSVLVIGLTHQLTITTVQQPLYKAANM GNFQDWTPFPPFILANKTHGFSIDCPIMRNSFLCHTLPTPVKLSEWERSTSTIYQTSPQV WITPEGKACLNHRNITVQDRTCLINKPGCFIPKHPWSAGKQTIVPTQYIQQNFVPDTIDT EDNQTRVLQKEMIEAISKAKRDYGVLKQGQIALIRHHEAITTILGQEATYSIKETQALIS SIEQEAWYNNLFSWYDGSVWSQLQLIIVVITCTIPLLWVLNTCLFFKLRRAIRRERDNNI VVEYQAQTRGRRTHMTEPITKKQRAKLLRHAKTNRRLPRSLRATPAVSAFEMVTFDPQEE TVEINRIDPSHENNDHGGPMNMAPIISADSYALPTPYITIMLDRELLNQGMRKVITLLND PAREVFNKAYNLVTTNHFTLAYGCDESAGWVNQHAEYMGKPVIVTLAGLVITPVGLAWIP LPQQEPLEKLFMVPNSMPHVTVAMADYHETKEMGKIVKDINNEELLLVKPQLFKWGPEGF FVACPLVIRGVVTGHSLLHIACPATAVQAEGT
Uniprot No.

Target Background

Function

The Walleye dermal sarcoma virus Envelope glycoprotein (env) mediates viral entry into host cells. The SU subunit binds to the host cell receptor, triggering a conformational change in the transmembrane protein (TM). This conformational change is believed to activate the fusion peptide, initiating membrane fusion at the host cell plasma membrane. TM acts as a class I viral fusion protein, existing in at least three conformational states: pre-fusion, pre-hairpin intermediate, and post-fusion hairpin. During fusion, coiled-coil regions (heptad repeats) form a trimer-of-hairpins structure, bringing the fusion peptide close to the C-terminal ectodomain. This structure drives the apposition and fusion of viral and target cell membranes, delivering the nucleocapsid into the cytoplasm.

Database Links

KEGG: vg:1403498

Subcellular Location
[Transmembrane protein]: Virion membrane; Multi-pass membrane protein. Host cell membrane; Multi-pass membrane protein.; [Surface protein]: Virion membrane; Peripheral membrane protein. Host cell membrane; Peripheral membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.