Recombinant Walleye dermal sarcoma virus ORF-B protein

Shipped with Ice Packs
In Stock

Description

Overview of Walleye Dermal Sarcoma Virus (WDSV)

Walleye dermal sarcoma virus (WDSV) is a complex retrovirus linked to seasonal skin tumors in walleye fish . These tumors, known as walleye dermal sarcomas, appear in the fall and winter and regress in the spring . WDSV encodes three accessory proteins: rv-cyclin (OrfA), Orf B, and Orf C, which regulate virus expression, tumor formation, and tumor regression .

Recombinant Walleye Dermal Sarcoma Virus Orf B Protein

The Orf B protein of WDSV is implicated in oncogenesis . Fall tumors show low levels of spliced accessory gene transcripts A and B, suggesting a role for Orf A and Orf B proteins in tumor development . The 35 kDa Orf B protein localizes to the cell periphery in structures similar to focal adhesions and along actin stress fibers in explanted tumor cells and mammalian cells .

Interaction with RACK1

Orf B binds to the cellular protein receptor for activated C kinase 1 (RACK1) in yeast two-hybrid assays and cell culture . Walleye RACK1 has high sequence conservation compared to other known RACK1 sequences . RACK1 binds to activated protein kinase C (PKC) . Orf B associates with PKCα, which is constitutively activated and localized at the membrane . Activated PKC promotes cell survival, proliferation, and increased cell viability in Orf B-expressing cells .

Role of Orf C in Apoptosis

Orf C contributes to the seasonal tumor regression observed in WDSV infections . Orf C targets the cell mitochondria and induces apoptosis . Studies using a recombinant lentivirus expressing WDSV Orf C (Lenti Orf C) showed decreasing cell viability with increasing virus concentrations . Orf C expression was found in mitochondrial, cytosolic, and nuclear cell fractions, with the strongest expression in cell nuclei . Two pro-apoptotic proteins, caspase 3 and PARP, were identified as interacting with Orf C, enhancing apoptosis in cells .

Recombinant Myxoma Virus Expressing WDSV OrfC (MYXVorfC)

To enhance apoptosis in cancer cells, the OrfC gene of WDSV was recombined into the myxoma virus (MYXV) genome, creating MYXVorfC . Cells infected with MYXVorfC showed a marked increase in apoptosis . Studies in New Zealand white rabbits, the only known host of MYXV, showed that MYXVorfC was attenuated compared to wild-type MYXV . Rabbits infected with MYXVorfC had a delayed onset of clinical signs and a longer median survival time . Virus titers recovered from tissues were lower in MYXVorfC-infected rabbits .

Impact on Immune Response

Rabbits infected with MYXVorfC showed clear evidence of lymphoid hyperplasia, which was lacking in MYXV-infected rabbits, suggesting a more effective immune response against MYXVorfC . Although not statistically significant, a slight increase in TUNEL positive cells was consistently observed in MYXVorfC-infected tissue, indicating enhanced apoptosis .

rv-cyclin (orfA) and Tissue Proliferation

Transgenic expression of WDSV rv-cyclin (orfA) in zebrafish did not result in tissue proliferation . Despite widespread expression of rv-cyclin in different tissues, the transgenic zebrafish remained viable and histologically normal for up to 2 years . No increase in tumors or tissue proliferation was observed following N-ethyl-N-nitrosourea exposure or tail wounding . These results indicate that rv-cyclin is not independently sufficient for tumor induction in zebrafish .

rv-cyclin and Transcription

WDSV rv-cyclin is associated with transcription complexes and affects transcription in a cell-type and promoter-dependent manner . It inhibits the WDSV promoter in walleye fibroblasts and activates transcription from GAL4 promoters when fused to the GAL4 DNA binding domain . rv-cyclin can block the pulldown of transcription coactivators by the AD of VP16, and the isolated rv-cyclin AD interferes specifically with the interaction between the carboxyl halves of the VP16 AD, VP16C, and TATA-binding protein-associated factor 9 (TAF9) .

Product Specs

Form
Supplied as a lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in your order notes for fulfillment according to your requirements.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to pellet the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting to -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference for your own protocol.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer components, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The specific tag will be determined during production. If you require a specific tag, please inform us, and we will prioritize its implementation.
Synonyms
ORF-B protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-306
Protein Length
full length protein
Species
Walleye dermal sarcoma virus (WDSV)
Target Protein Sequence
MFSDSDSSDEELSRIITDIDESPQDIQQSLHLRAGVSPEARVPPGGLTQEEWTIDYFSTY HTPLLNPGIPHELTQRCTDYTASILRRASAKMIQWDYVFYLLPRVWIMFPFIAREGLSHL THLLTLTTSVLSATSLVFGWDLTVIELCNEMNIQGVYLPEVIEWLAQFSFLFTHVTLIVV SDGMMDLLLMFPMDIEEQPLAINIALHALQTSYTIMTPILFASPLLRIISCVLYACGHCP SARMLYAYTIMNRYTGESIAEMHTGFRCFRDQMIAYDMEFTNFLRDLTEEETPVLEITEP EPSPTE
Uniprot No.

Target Background

Database Links

KEGG: vg:1403499

Subcellular Location
Host cytoplasm. Host cell membrane; Multi-pass membrane protein.

Q&A

What is Walleye dermal sarcoma virus and what role does ORF-B play in its lifecycle?

Walleye dermal sarcoma virus (WDSV) is a complex retrovirus etiologically associated with walleye dermal sarcomas, which exhibit a unique seasonal pattern of development and regression. WDSV belongs to the Epsilonretrovirus genus and contains the standard retroviral genes (gag, pol, and env) plus three accessory genes: orf a, orf b, and orf c .

ORF-B is a 35 kDa accessory protein encoded by one of the spliced accessory gene transcripts detected during tumor development . The temporal expression pattern of ORF-B suggests it plays a critical role in oncogenesis, as developing tumors in fall contain low levels of spliced accessory gene transcripts, including ORF-B, while regressing tumors in spring show high levels of full-length genomic RNA and various subgenomic transcripts . These expression patterns strongly indicate that ORF-B contributes to tumor cell proliferation during the development phase of the disease.

How does ORF-B protein cellular localization inform its function?

In explanted tumor cells, the ORF-B accessory protein localizes to the cell periphery in structures resembling focal adhesions and along actin stress fibers . This distinctive localization pattern, which is observed in both walleye tumor cells and mammalian cells expressing the protein, provides important clues about its function.

The peripheral localization suggests that ORF-B interacts with cellular components involved in cell adhesion, cytoskeletal organization, and signaling pathways that regulate cell growth and survival. This distribution is consistent with ORF-B's demonstrated interaction with RACK1 (receptor for activated C kinase 1) and its effects on PKCα (protein kinase C alpha) localization and activation . The association with actin stress fibers further indicates potential involvement in cytoskeletal regulation, which may contribute to the altered growth properties of infected cells.

What protein-protein interactions have been identified for WDSV ORF-B and how do they contribute to oncogenesis?

The most significant protein interaction identified for ORF-B is with receptor for activated C kinase 1 (RACK1) . This interaction was demonstrated through multiple experimental approaches:

  • Yeast two-hybrid assays showed binding between ORF-B and RACK1

  • The interaction was confirmed in cell culture systems

  • Sequence analysis revealed high conservation between walleye RACK1 and other known RACK1 sequences, indicating evolutionary importance of this interaction

This interaction is particularly significant because RACK1 is known to bind activated protein kinase C (PKC). Research has shown that ORF-B associates with PKCα, which becomes constitutively activated and localized to the membrane in cells expressing ORF-B .

The functional consequence of these interactions is the activation of PKC and AKT signaling pathways, which promotes:

  • Cell survival

  • Cellular proliferation

  • Increased cell viability

These effects directly contribute to the oncogenic properties of WDSV by promoting tumor cell growth and preventing apoptosis during the tumor development phase .

How does ORF-B protein modify cellular signaling pathways to influence cell cycle and survival?

ORF-B protein acts as a signaling modifier that alters cellular regulatory pathways in ways that promote tumor development. Based on experimental evidence, ORF-B influences cell cycle and survival through several mechanisms:

Together, these modifications create a cellular environment that promotes proliferation while inhibiting apoptosis, characteristics that are essential for tumor development. These alterations are particularly significant during the fall tumor development phase when ORF-B is expressed at detectable levels while full viral replication is suppressed .

What are the optimal methods for producing and purifying recombinant WDSV ORF-B protein for in vitro studies?

For effective production and purification of recombinant WDSV ORF-B protein, researchers should consider the following methodological approach:

  • Expression System Selection:

    • Bacterial systems (E. coli) provide high yield but may lack post-translational modifications

    • Mammalian expression systems (such as HEK293 or CHO cells) are recommended for experiments requiring proper protein folding and modifications

    • Insect cell/baculovirus systems offer a compromise between yield and proper folding

  • Vector Design:

    • Include an appropriate tag (His, GST, or FLAG) to facilitate purification

    • Codon optimization may improve expression efficiency in the chosen host

    • Consider including a cleavable tag if the tag might interfere with functional studies

  • Purification Protocol:

    • For His-tagged proteins: Immobilized metal affinity chromatography (IMAC)

    • For GST-tagged proteins: Glutathione sepharose affinity chromatography

    • Follow with size exclusion chromatography to improve purity

    • Consider ion exchange chromatography for removal of nucleic acid contaminants

  • Storage Conditions:

    • Store in Tris-based buffer with 50% glycerol optimized for protein stability

    • Maintain at -20°C for short-term or -80°C for long-term storage

    • Avoid repeated freeze-thaw cycles; prepare working aliquots

    • For short-term work, store aliquots at 4°C for up to one week

  • Quality Control:

    • Verify purity by SDS-PAGE

    • Confirm identity by Western blot or mass spectrometry

    • Assess activity through functional assays relevant to ORF-B (e.g., RACK1 binding assays)

These methodological considerations are essential for obtaining functional recombinant ORF-B protein suitable for downstream experimental applications.

What experimental approaches are most effective for studying ORF-B interactions with host proteins like RACK1?

Several complementary experimental approaches can be employed to study ORF-B interactions with host proteins like RACK1:

  • In vitro Binding Assays:

    • Pull-down assays using purified recombinant proteins

    • Surface plasmon resonance (SPR) to determine binding kinetics

    • Isothermal titration calorimetry (ITC) for thermodynamic parameters

    • ELISA-based interaction assays

  • Cell-Based Interaction Studies:

    • Co-immunoprecipitation (Co-IP) from cells expressing both proteins

    • Proximity ligation assay (PLA) to visualize interactions in situ

    • FRET or BRET analysis for real-time interaction monitoring

    • Mammalian two-hybrid assays

  • Structural Studies:

    • X-ray crystallography of the protein complex

    • NMR spectroscopy for dynamic interaction analysis

    • Cryo-electron microscopy for larger complexes

    • Hydrogen-deuterium exchange mass spectrometry (HDX-MS) to map interaction interfaces

  • Functional Validation:

    • Mutagenesis of key residues identified in binding interfaces

    • Domain mapping to identify minimal interaction regions

    • Competition assays with peptides derived from interaction interfaces

    • Cellular localization studies using fluorescently tagged proteins

  • Systems-Level Analysis:

    • Proteomics approaches such as BioID or APEX proximity labeling

    • Global protein-protein interaction mapping using IP-mass spectrometry

    • Analysis of downstream signaling effects using phospho-proteomics

How can recombinant ORF-B protein be utilized to study the mechanisms of seasonal tumor development and regression in walleye?

Recombinant ORF-B protein offers unique opportunities to investigate the seasonal nature of walleye dermal sarcomas through several advanced experimental approaches:

  • Temperature-Dependent Activity Studies:

    • Given that WDSV replication occurs at temperatures near 4°C , investigate whether ORF-B's interaction with RACK1 and its effects on PKC activation are temperature-dependent

    • Compare protein activity and stability across temperature ranges that mimic seasonal changes (4°C for winter/spring, 15-20°C for summer/fall)

    • Establish in vitro systems that model temperature-dependent tumor growth and regression

  • Temporal Expression Modeling:

    • Develop cellular models with inducible ORF-B expression to simulate the temporal pattern observed in natural infections

    • Create experimental systems where ORF-B expression can be shut off to model transition from tumor development to regression

    • Study the differential effects of short-term versus long-term ORF-B expression on cell signaling

  • Interaction with Other WDSV Components:

    • Investigate potential interactions between ORF-B and other viral proteins, particularly ORF-A (rv-cyclin) and ORF-C

    • Examine how these interactions might be modulated by temperature changes

    • Establish whether the combined action of ORF-A and ORF-B creates the conditions for seasonal tumor development

  • Cross-Species Comparative Analyses:

    • Compare the activity of recombinant ORF-B in walleye cells versus mammalian cells at different temperatures

    • Study how species-specific variations in RACK1 and PKC might influence ORF-B's tumorigenic potential

    • Determine whether ORF-B's functions are adapted to the poikilothermic nature of its natural host

These approaches could provide critical insights into the unique seasonal pattern of WDSV-associated tumors and potentially reveal novel mechanisms of viral oncogenesis that are regulated by environmental factors.

What is the relationship between ORF-B and the retroviral cyclin (rv-cyclin) encoded by ORF-A in WDSV oncogenesis?

The relationship between ORF-B and the retroviral cyclin (rv-cyclin) encoded by ORF-A represents one of the most fascinating aspects of WDSV biology, as both proteins appear to contribute to oncogenesis through distinct but potentially complementary mechanisms:

  • Temporal Co-expression:

    • Both ORF-A and ORF-B transcripts are detected at low levels in developing tumors but not in regressing tumors

    • This co-expression pattern suggests coordinated functions during tumor development

  • Complementary Functional Mechanisms:

    • ORF-A (rv-cyclin) functions as a D-cyclin homologue that can rescue cyclin-deficient yeast from growth arrest

    • ORF-A contains both a cyclin box fold and an acidic transcription activation domain with a TAF9 binding motif

    • ORF-B activates PKC and AKT signaling pathways through interaction with RACK1

    • Together, these functions potentially create a powerful oncogenic environment: rv-cyclin drives cell cycle progression while ORF-B promotes cell survival and proliferation

  • Experimental Evidence from Transgenic Models:

    • Transgenic mice expressing rv-cyclin develop severe squamous epithelial hyperplasia and dysplasia following injury

    • The rv-cyclin protein is detected in thickened basal cell layers of proliferating lesions

    • While similar transgenic models for ORF-B have not been reported in the literature provided, the in vitro data suggests it would similarly promote proliferation

  • Hypothesized Cooperative Mechanism:

    • ORF-A may drive cell cycle entry and progression

    • ORF-B may enhance survival signaling and prevent apoptosis

    • Together, they could create an environment permissive for tumor growth while suppressing virus production until conditions favor viral replication and transmission

This relationship represents an elegant viral strategy where two accessory proteins with distinct cellular targets work in concert to modify host cell behavior for viral advantage, suggesting that both proteins would need to be targeted for effective intervention strategies.

How might the study of ORF-B contribute to our understanding of human retroviral oncogenesis?

The study of WDSV ORF-B offers valuable insights into human retroviral oncogenesis through several translational research perspectives:

  • Novel Mechanisms of Viral Oncogenesis:

    • ORF-B's interaction with RACK1 and activation of PKC represents a mechanism distinct from classic retroviral oncogenes

    • This pathway may reveal previously unrecognized mechanisms by which human retroviruses could induce cellular transformation

    • Understanding these alternative oncogenic mechanisms might explain aspects of human retroviral pathogenesis that aren't accounted for by current models

  • Convergent Evolutionary Strategies:

    • Although WDSV is classified as an Epsilonretrovirus and is distantly related to human retroviruses , oncogenic strategies may converge evolutionarily

    • Comparing ORF-B's mechanisms with those of human retroviral accessory proteins may reveal fundamental principles of how retroviruses manipulate cell signaling

    • Such comparisons could identify conserved cellular targets that might be exploitable for broad-spectrum antiviral or anti-cancer therapies

  • Signaling Pathway Insights:

    • ORF-B's effects on PKC and potentially AKT signaling pathways have direct relevance to human cancer biology

    • These pathways are frequently dysregulated in human cancers, including those with viral etiology

    • Mechanistic details of how ORF-B manipulates these pathways could reveal new therapeutic targets or biomarkers

  • Temporal Regulation of Viral Oncogenesis:

    • The seasonal nature of WDSV tumors, with active tumor growth followed by regression, provides a unique model for studying viral strategies that balance oncogenesis with viral replication and transmission

    • This model may provide insights into how human oncogenic viruses navigate similar trade-offs, potentially informing approaches to trigger regression of virus-associated human tumors

  • Experimental Model Development:

    • Methods developed to study ORF-B could be adapted to study poorly understood accessory proteins of human retroviruses

    • The protein interaction prediction methods described in search result could be particularly valuable for identifying human protein partners of retroviral accessory proteins

These translational perspectives highlight how fundamental research on fish retroviruses can contribute to our understanding of human disease, particularly in revealing conserved mechanisms that might not be immediately apparent from studying human systems alone.

What are the common challenges in experimental work with recombinant ORF-B protein and how can they be addressed?

Working with recombinant WDSV ORF-B protein presents several technical challenges that researchers should anticipate and address:

  • Protein Solubility Issues:

    • Challenge: ORF-B's association with membrane structures suggests it may have hydrophobic regions that could affect solubility

    • Solution: Consider fusion tags that enhance solubility (MBP, SUMO); optimize buffer conditions with mild detergents; explore refolding protocols if expression yields inclusion bodies

  • Temperature Sensitivity:

    • Challenge: Given that WDSV replicates at cold temperatures (~4°C) , ORF-B may exhibit temperature-dependent conformational changes or activity

    • Solution: Perform purification and functional assays at lower temperatures; include temperature as an experimental variable; consider using cold-adapted expression systems

  • Protein-Protein Interaction Preservation:

    • Challenge: Maintaining native interaction capabilities with partners like RACK1

    • Solution: Verify functionality post-purification using binding assays; optimize buffer conditions to maintain native conformation; consider co-expression with binding partners

  • Post-Translational Modifications:

    • Challenge: Potential loss of important modifications in bacterial expression systems

    • Solution: Consider eukaryotic expression systems (insect or mammalian cells) when post-translational modifications may be critical; verify modification status by mass spectrometry

  • Functional Verification:

    • Challenge: Confirming that recombinant ORF-B retains native functions

    • Solution: Establish robust functional assays based on known activities (RACK1 binding, PKC activation); compare activity of protein expressed in different systems; use well-characterized cellular phenotypes as readouts

  • Experimental Design Considerations:

    • Challenge: Designing experiments that accurately model ORF-B's natural context

    • Solution: Consider co-expression with other viral proteins; test function in fish cell lines when possible; account for temperature effects in experimental design

  • Data Interpretation Complexities:

    • Challenge: Distinguishing ORF-B-specific effects from general effects of protein overexpression

    • Solution: Include appropriate controls (inactive mutants, unrelated proteins of similar size); titrate expression levels; validate findings using multiple approaches

By anticipating these challenges and implementing appropriate methodological solutions, researchers can enhance the reliability and relevance of their studies with recombinant WDSV ORF-B protein.

How can researchers design experiments to distinguish between ORF-B-specific effects and non-specific consequences of protein expression?

Designing experiments that clearly distinguish specific ORF-B effects from non-specific consequences requires rigorous controls and methodological considerations:

By implementing these experimental design principles, researchers can build a compelling case for ORF-B-specific effects while minimizing confounding factors that complicate interpretation of results.

What are the most promising avenues for future research on WDSV ORF-B protein and its role in viral oncogenesis?

Several promising research directions could significantly advance our understanding of WDSV ORF-B and viral oncogenesis:

These research directions promise to yield insights not only into WDSV biology but also into fundamental mechanisms of viral oncogenesis that may have broader implications for understanding and treating virus-associated cancers.

How might high-throughput protein interaction prediction methods be applied to better understand the ORF-B interactome?

High-throughput protein interaction prediction methods offer powerful approaches to comprehensively map the ORF-B interactome and place it in the context of cellular signaling networks:

  • Application of MP-PIPE and Similar Prediction Tools:

    • The Protein Interaction Prediction Engine (PIPE) and its multi-parallel implementation (MP-PIPE) described in search result could be adapted to predict interactions between ORF-B and host proteins

    • These methods use co-occurrence of short polypeptide regions to detect novel protein-protein interactions

    • The efficiency of MP-PIPE allows for proteome-scale prediction, which would be valuable for identifying the full range of potential ORF-B interactors

  • Integration with Experimental Validation:

    • High-confidence predictions from computational methods can be prioritized for experimental validation

    • Use a tiered validation approach: starting with in vitro binding assays for high-confidence predictions, followed by cell-based assays for confirmed interactions

    • Apply the metrics described in Table 4 of search result to evaluate the biological relevance of predicted interactions:

    Evaluation MetricThreshold for Significance
    Cellular component (CC) co-localization>64.1%
    Molecular function (MF) similarity>43.9%
    Biological process (BP) involvement>30.8%
    CC & MF & BP combined>20.6%
    Third party interaction>23.9%
  • Network Analysis Approaches:

    • Construct interaction networks centered on ORF-B to identify key hubs and modules

    • Compare the ORF-B interactome with those of other viral oncoproteins to identify common targets

    • Apply network perturbation analysis to predict the systemic effects of ORF-B expression

  • Evolutionary Context Integration:

    • Analyze the conservation of predicted interaction interfaces across species

    • Investigate whether ORF-B preferentially targets evolutionarily conserved proteins

    • Compare interaction predictions across different fish species to identify host-specific adaptations

  • Machine Learning Extensions:

    • Train machine learning models on known viral-host protein interactions to improve prediction accuracy

    • Incorporate structural information to enhance the specificity of interaction predictions

    • Develop models that can predict not just binary interactions but also their functional consequences

  • Application to Drug Discovery:

    • Use interaction predictions to identify "druggable" nodes in the ORF-B cellular network

    • Design peptide inhibitors that mimic interaction interfaces

    • Prioritize targets based on their centrality in the ORF-B-perturbed network

These approaches could rapidly expand our understanding of how ORF-B rewires cellular signaling networks to promote oncogenesis, potentially revealing unexpected connections that would not be identified through traditional one-interaction-at-a-time approaches.

How does ORF-B compare functionally with other retroviral oncoproteins and what can be learned from these comparisons?

Comparing WDSV ORF-B with other retroviral oncoproteins reveals important insights about diverse mechanisms of viral oncogenesis:

These comparisons highlight the diversity of mechanisms by which retroviruses can induce oncogenesis and suggest that ORF-B represents a unique strategy that may have evolved specifically in the context of seasonally regulated tumors in poikilothermic hosts.

What can the study of temperature-dependent aspects of ORF-B function reveal about viral adaptation to host environments?

The temperature-dependent aspects of ORF-B function offer unique insights into viral adaptation to host environments, particularly for viruses that infect poikilothermic (cold-blooded) animals:

  • Thermal Biology of WDSV Replication:

    • WDSV naturally replicates in fish at temperatures near 4°C , presenting a distinct adaptation to its poikilothermic host

    • Research has shown that WDSV reverse transcriptase is rapidly inactivated at temperatures greater than 15°C

    • This suggests that ORF-B may also exhibit temperature-dependent functional properties that could influence its oncogenic potential

  • Temperature as a Regulatory Switch:

    • The seasonal pattern of WDS tumor development (fall/winter) and regression (spring) correlates with water temperature changes

    • This pattern suggests temperature could act as an environmental switch that regulates the balance between ORF-B-driven tumor development and virus replication/tumor regression

    • Studying how ORF-B function changes across temperature ranges could reveal mechanisms underlying this seasonal pattern

  • Protein Structural Adaptations:

    • Comparative structural analysis of ORF-B with proteins from warm-blooded hosts could reveal adaptations for function at lower temperatures

    • Features such as increased flexibility, altered surface charge distribution, or modified hydrophobic cores might be present

    • These adaptations could represent generalizable principles of protein cold adaptation

  • Signaling Pathway Temperature Sensitivity:

    • Investigation of how temperature affects the interaction between ORF-B and RACK1, and subsequent PKC activation

    • Determination of whether signaling pathways activated by ORF-B show different temperature optima compared to mammalian systems

    • Potential discovery of temperature-sensitive regulatory mechanisms that have been selected for during viral evolution

  • Host-Pathogen Co-evolution:

    • Analysis of whether temperature-dependent aspects of ORF-B function represent adaptations to the host's immune response at different temperatures

    • Investigation of potential seasonal variations in walleye immune function that might have driven viral adaptation

    • Insights into how environmental factors shape the evolution of viral oncogenes

Understanding these temperature-dependent aspects would not only clarify WDSV biology but could also provide broader insights into how viruses adapt to diverse host environments and how environmental factors can regulate viral gene function. This knowledge could potentially inform the development of novel therapeutic approaches that exploit temperature sensitivity or other environmental dependencies of viral proteins.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.