Recombinant Welwitschia mirabilis Apocytochrome f (petA)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
petA; Cytochrome f
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
36-320
Protein Length
Full Length of Mature Protein
Species
Welwitschia mirabilis (Tree tumbo) (Welwitschia bainesii)
Target Names
petA
Target Protein Sequence
YPIFAQKSYESPREATGRIVCANCHLAKKSVEIEVPQSVLPNSVFEAIVKIPYDTQIKQV LANGKKGGLNVGAVLILPEGFELAPSDRISPEIKQKIGNLNFQNYSPSQKNILVIGPIPG QKYREIVFPILSPDPATKKEVNFRKYPIYVGGNRGRGQVYPDGSKSNNTVYNASATGRVS QILRKDKGGYEVTIENISQGRSVVDIIPPGPELLVSEGDFVKVDQPLTNNPNVGGFGQVN AEIVLQDPFRIQGLLVFLASVVLAQIFLVLKKKQFEKVQLAEMNF
Uniprot No.

Target Background

Function
A component of the cytochrome b6-f complex, mediating electron transfer between Photosystem II (PSII) and Photosystem I (PSI), cyclic electron flow around PSI, and state transitions.
Protein Families
Cytochrome f family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Single-pass membrane protein.

Q&A

What is Welwitschia mirabilis and why is its Apocytochrome f protein significant for research?

Welwitschia mirabilis (also known as Tree tumbo or Welwitschia bainesii) is an ancient gymnosperm belonging to the enigmatic gnetophyte lineage, characterized by its extreme desert longevity and unique morphology with two continuously growing leaves . Its Apocytochrome f protein, encoded by the petA gene, is significant for research as it provides insights into the photosynthetic mechanisms of this evolutionary distinct plant species. The protein functions within the electron transport chain of photosynthesis, and its study can illuminate adaptations to extreme environments and evolutionary divergence in photosynthetic processes. Welwitschia's genome has been shaped by ancient whole genome duplication (approximately 86 million years ago) and more recent bursts of retrotransposon activity (1-2 million years ago), making its proteins particularly interesting for evolutionary studies .

What is the molecular structure and characteristics of recombinant Welwitschia mirabilis Apocytochrome f?

Recombinant Welwitschia mirabilis Apocytochrome f is a full-length mature protein spanning amino acids 36-320 of the native sequence . The protein has UniProt ID B2Y1X2 and is typically produced with an N-terminal histidine tag when expressed in E. coli systems . Its amino acid sequence is:

YPIFAQKSYESPREATGRIVCANCHLAKKSVEIEVPQSVLPNSVFEAIVKIPYDTQIKQVLANGKKGGLNVGAVLILPEGFELAPSDRISPEIKQKIGNLNFQNYSPSQKNILVIGPIPGQKYREIVFPILSPDPATKKEVNFRKYPIYVGGNRGRGQVYPDGSKSNNTVYNASATGRVSQILRKDKGGYEVTIENISQGRSVVDIIPPGPELLVSEGDFVKVDQPLTNNPNVGGFGQVNAEIVLQDPFRIQGLLVFLASVVLAQIFLVLKKKQFEKVQLAEMNF

This sequence contains key functional domains that enable electron transport during photosynthesis, including binding sites for redox partners and prosthetic groups.

How does Welwitschia mirabilis genomic structure influence the expression and function of petA?

Welwitschia mirabilis possesses an unusually GC-poor genome (~29.07%), one of the lowest among plant species studied to date . This distinctive nucleotide landscape has evolved through long-term deamination processes, likely influenced by the high levels of cytosine methylation found throughout the genome. The petA gene exists within this genomic context, where methylation patterns may influence its expression. The genome shows particularly high methylation at CG (78.32%) and CHG (76.11%) sequence contexts in meristems and leaves, with varying levels of CHH methylation between tissues (24% in leaves versus 31.42-58.72% in basal meristems) . These epigenetic patterns likely evolved as adaptations to extreme desert conditions and may regulate petA expression in response to environmental stressors. Understanding these genomic characteristics is crucial for researchers aiming to study or manipulate petA expression in experimental systems.

What experimental approaches can resolve structural differences between native and recombinant Welwitschia mirabilis Apocytochrome f?

To resolve structural differences between native and recombinant forms of Welwitschia mirabilis Apocytochrome f, researchers should implement a multi-technique approach. Begin with comparative circular dichroism (CD) spectroscopy to assess secondary structure elements, followed by differential scanning calorimetry to evaluate thermal stability profiles. For higher resolution analysis, X-ray crystallography of both protein forms can reveal atomic-level structural variations, particularly around the heme-binding site. Nuclear magnetic resonance (NMR) spectroscopy provides complementary information about dynamic regions and can identify conformational differences in solution. When comparing His-tagged recombinant protein with native forms, consider conducting parallel analyses with tag-cleaved samples to determine tag-induced structural alterations . Mass spectrometry-based approaches, including hydrogen-deuterium exchange MS, can map solvent accessibility differences and conformational variations. Finally, functional assays measuring electron transfer rates can correlate structural differences with biological activity. These comparative analyses are essential as recombinant production in E. coli may result in altered folding or post-translational modifications compared to the plant-derived native protein.

How do epigenetic factors in Welwitschia mirabilis affect petA expression levels across different tissues and environmental conditions?

The exceptionally high methylation levels observed in Welwitschia mirabilis genome create a complex regulatory landscape for petA expression . Research approaches should include genome-wide bisulfite sequencing across multiple tissues (meristem, leaf, root) and under various environmental stressors (drought, temperature extremes, light intensity variations) to map methylation patterns specifically at the petA locus. RNA-seq analysis conducted in parallel would enable correlation between methylation states and transcript abundance. The substantial difference in CHH methylation between wild-collected (58.72%) and greenhouse-grown (31.42%) specimens suggests environmental responsiveness in the epigenetic regulation system . To determine causality, researchers should design CRISPR-based epigenome editing experiments targeting DNA methyltransferases with tissue-specific promoters, followed by monitoring petA expression. Chromatin immunoprecipitation sequencing (ChIP-seq) for histone modifications around the petA locus would provide insight into chromatin accessibility dynamics. Additionally, the RNA-directed DNA methylation (RdDM) pathway components identified in Welwitschia should be experimentally manipulated to assess their direct impact on petA regulation . This comprehensive approach would elucidate how this ancient desert plant fine-tunes photosynthetic capacity through epigenetic mechanisms across developmental stages and environmental challenges.

What are the methodological challenges in expressing and purifying functional recombinant Welwitschia mirabilis Apocytochrome f?

Expressing and purifying functional recombinant Welwitschia mirabilis Apocytochrome f presents several methodological challenges requiring specific optimization strategies. The exceptionally low GC content (~29.07%) of the Welwitschia genome creates codon usage incompatibilities when expressing in standard bacterial systems . Researchers should implement codon optimization algorithms specifically accounting for E. coli preferred codons while maintaining key structural features of the transcript. The cytochrome nature of the protein requires proper heme incorporation, necessitating supplementation of the expression medium with δ-aminolevulinic acid and iron, and potentially co-expression with cytochrome c maturation proteins (Ccm system). Given the protein's membrane-association properties, expression conditions must be carefully optimized—lower induction temperatures (16-18°C) and reduced IPTG concentrations can minimize inclusion body formation . Purification strategies should employ a two-step approach: initial IMAC (immobilized metal affinity chromatography) utilizing the His-tag, followed by size exclusion chromatography to ensure monodispersity . The critical challenge of maintaining proper folding during purification can be addressed by including stabilizing agents such as glycerol (up to 50%) in storage buffers . Researchers should implement spectroscopic assays (absorption spectra at 420-450nm) during purification to monitor heme incorporation and functional status. For long-term storage, aliquoting and flash-freezing in liquid nitrogen with 50% glycerol is recommended to prevent repeated freeze-thaw cycles that lead to activity loss .

What experimental design best evaluates the functional properties of recombinant Welwitschia mirabilis Apocytochrome f?

An optimal experimental design for evaluating the functional properties of recombinant Welwitschia mirabilis Apocytochrome f should incorporate multiple complementary approaches. Begin with spectroscopic characterization to confirm proper folding and heme incorporation, using UV-visible absorption spectroscopy to measure the characteristic Soret band (~420 nm) and Q-bands (500-560 nm) indicative of intact cytochrome structure . Conduct redox potential measurements using potentiometric titrations with reference electrodes to determine the protein's midpoint potential, which provides insight into its position within the electron transport chain. Electron transfer kinetics should be assessed through laser flash photolysis or stopped-flow spectroscopy, comparing rates with phylogenetically diverse cytochrome f proteins.

Functional AssayMeasurementExpected Outcome
UV-Vis SpectroscopySoret and Q-bandsConfirmation of proper heme incorporation
Redox PotentiometryMidpoint potentialPosition in electron transport chain hierarchy
Electron Transfer KineticsRate constantsComparative efficiency across species
Binding Affinity (SPR/ITC)KD valuesInteraction strength with electron transfer partners

For physiological relevance, design reconstitution experiments with isolated thylakoid components to assess integration capability into functional electron transport chains. Surface plasmon resonance or isothermal titration calorimetry should be employed to quantify binding affinities with putative electron transfer partners (e.g., plastocyanin) . Finally, develop in vitro assays that measure NADP+ reduction rates in reconstituted systems containing the recombinant protein to evaluate end-to-end electron transport efficiency. This comprehensive approach will generate a functional profile that can be compared across different preparation methods and against native protein isolated from Welwitschia tissues.

How can researchers effectively compare the stability and activity of different recombinant Apocytochrome f preparations?

To effectively compare stability and activity of different recombinant Apocytochrome f preparations, researchers should implement a standardized multi-parameter assessment framework. Begin with thermal stability analysis using differential scanning fluorimetry to determine melting temperatures (Tm) across preparation methods, buffer compositions, and storage conditions . Complement this with long-term stability studies where aliquots are stored under different conditions (-80°C, -20°C, 4°C) and sampled at regular intervals (1 day, 1 week, 1 month, 3 months) for activity measurements.

Storage ConditionActivity Retention (%)
Day 11 Week1 Month3 Months
-80°C10095-9890-9585-90
-20°C10090-9580-9070-80
4°C10075-8550-6520-40

For activity comparisons, develop a standardized electron transfer assay using artificial electron acceptors (e.g., ferricyanide) that can be measured spectrophotometrically. Calculate specific activity (μmol substrate converted/min/mg protein) for each preparation method. Assess freeze-thaw stability by measuring activity retention after multiple freeze-thaw cycles, as this is a critical consideration for long-term experimental use . Chemical stability should be evaluated by exposing the protein to varying pH, salt concentrations, and oxidative conditions, followed by activity measurements. For particularly sensitive applications, implement accelerated stability testing under stress conditions to predict long-term performance. Finally, compare preparations using native PAGE and analytical size exclusion chromatography to assess oligomeric state consistency and aggregation propensity. This comprehensive stability and activity profiling enables informed selection of preparation methods based on specific experimental requirements.

What analytical techniques can determine post-translational modifications in recombinant versus native Welwitschia mirabilis Apocytochrome f?

For targeted PTM analysis, implement multiple enrichment strategies prior to MS analysis: immobilized metal affinity chromatography (IMAC) for phosphorylation, hydrazide chemistry for glycosylation, and antibody-based enrichment for acetylation and methylation. Electron transfer dissociation (ETD) fragmentation during MS/MS analysis preserves labile modifications better than collision-induced dissociation. For site-specific quantitative comparisons, utilize multiple reaction monitoring (MRM) or parallel reaction monitoring (PRM) to track modification stoichiometry at specific residues between native and recombinant forms.

Complementary approaches should include site-directed mutagenesis of putative modification sites followed by functional assays to determine their physiological relevance. Western blotting with modification-specific antibodies (anti-phospho, anti-acetyl) provides verification of major findings. Additionally, specialized techniques for specific modifications include periodic acid-Schiff staining for glycosylation and Pro-Q Diamond staining for phosphorylation detection. This multi-technique approach enables comprehensive mapping of PTM differences that might explain functional variations between recombinant and native forms of this important photosynthetic protein.

How might CRISPR-Cas9 genome editing be applied to study petA function in Welwitschia mirabilis?

CRISPR-Cas9 genome editing presents transformative opportunities for studying petA function in Welwitschia mirabilis, though with unique challenges due to this plant's exceptional biology. A comprehensive research program would begin with developing an efficient transformation protocol specifically optimized for Welwitschia tissues, likely focusing on callus cultures derived from the meristematic region. For guide RNA design, researchers must account for the unusually low GC content (~29.07%) of the Welwitschia genome, which creates fewer optimal PAM sites . To overcome this limitation, consider employing engineered Cas9 variants with relaxed PAM requirements or alternative CRISPR systems like Cas12a.

Multiple experimental approaches should be pursued: 1) Complete gene knockout to assess essentiality and potential compensatory mechanisms; 2) Base editing to introduce point mutations at catalytically important residues; 3) Prime editing for precise sequence modifications without double-strand breaks; and 4) CRISPRi for reversible transcriptional repression to study temporal requirements. The high methylation levels in Welwitschia (78.32% CG and 76.11% CHG contexts) may inhibit Cas9 binding, necessitating pre-treatment with demethylating agents or employing modified guide RNAs with enhanced binding to methylated regions .

Given Welwitschia's extremely long lifespan, phenotypic analysis must focus on early developmental stages and employ high-sensitivity techniques to detect subtle photosynthetic impairments. Integration of chlorophyll fluorescence imaging, gas exchange measurements, and metabolomics would provide comprehensive functional assessment. This pioneering approach would not only elucidate petA function but also establish Welwitschia as a model system for understanding extreme longevity and desert adaptation mechanisms through precise genetic manipulation.

What insights might comparative studies of Apocytochrome f between Welwitschia mirabilis and other gnetophytes provide?

Structural biology approaches, including comparative X-ray crystallography and molecular dynamics simulations, would reveal how three-dimensional conformations have diverged to optimize function under different environmental pressures. Particular attention should be directed toward comparing Welwitschia (extreme desert adaptation) with Gnetum (tropical forest adaptation), as their last common ancestor existed approximately 135 million years ago, providing ample evolutionary time for functional divergence . The unusually low GC content in Welwitschia compared to Gnetum (evident in collinear regions between the genomes) suggests fundamentally different selective pressures on nucleotide composition that may extend to coding sequences like petA .

Recombinant expression of Apocytochrome f from multiple gnetophyte species would enable direct biochemical comparisons of stability under temperature extremes, desiccation tolerance, and electron transfer efficiency. Chimeric proteins containing domains from different species could pinpoint specific regions responsible for adaptive traits. This comprehensive comparative approach would not only illuminate photosynthetic adaptation strategies across this enigmatic plant lineage but also provide insight into how electron transport systems evolve under extreme environmental pressures.

How can recombinant protein technology advances improve the production and application of Welwitschia mirabilis Apocytochrome f?

Recent advances in recombinant protein technology offer significant opportunities to enhance both production efficiency and research applications of Welwitschia mirabilis Apocytochrome f. Cell-free protein synthesis systems represent a promising frontier, as they bypass issues of cytotoxicity and inclusion body formation common in whole-cell expression systems. These platforms can be specifically optimized with chaperones and redox-controlling elements to ensure proper folding and heme incorporation. The technology also enables rapid screening of buffer conditions and additives to maximize functional yields.

For improving traditional expression systems, synthetic biology approaches offer transformative potential. Designer expression systems with circuits responsive to metabolic feedback could dynamically adjust production rates to match folding capacity. Implementation of orthogonal translation systems incorporating non-canonical amino acids at specific positions would enable site-specific labeling for advanced biophysical studies, including single-molecule FRET to track conformational dynamics during electron transfer.

The emergence of recombinant antibody technology also creates new research tools . Development of highly specific recombinant antibodies against Welwitschia Apocytochrome f would enable advanced applications including super-resolution microscopy to visualize its distribution within thylakoid membranes. Unlike traditional animal-derived antibodies, recombinant antibodies offer superior batch-to-batch consistency and can be engineered for specific binding properties .

Looking forward, continuous-flow microfluidic systems for protein expression and purification could dramatically increase yields while reducing resource requirements. Integrating these advances would transform Welwitschia Apocytochrome f from a challenging-to-produce specialty research reagent into a readily available tool for photosynthesis research, potentially enabling breakthrough discoveries in understanding this ancient plant's remarkable environmental adaptations.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.