Recombinant Welwitschia mirabilis ATP synthase subunit b, chloroplastic (atpF)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, but this can be adjusted to your needs.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type will be determined during the production process. If you require a specific tag type, please inform us, and we will prioritize its development.
Synonyms
atpF; ATP synthase subunit b, chloroplastic; ATP synthase F(0 sector subunit b; ATPase subunit I
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-182
Protein Length
full length protein
Species
Welwitschia mirabilis (Tree tumbo) (Welwitschia bainesii)
Target Names
atpF
Target Protein Sequence
MKEVINSLNYLSNWPSAGSFEFNTNILETNIINISVVLGVLVYFGKGVLSNLLDNRKSKI LNTIQNSEELCKGATDQLEKARARLWEVEKRVDEIRVNGYLQIEQEKENLIKAASANLKQ LEDSKNETIFFEQQKVIDQVRQQISYQALQKALAIMNNCLNTDLHLRMIDYNIGRLRAKK PN
Uniprot No.

Target Background

Function
F(1)F(0) ATP synthase synthesizes ATP from ADP using a proton or sodium gradient. This enzyme comprises two domains: the extramembranous catalytic F(1) domain and the membrane-bound proton channel F(0) domain, connected by a central and peripheral stalk. ATP synthesis in the F(1) catalytic domain is coupled to proton translocation via a rotary mechanism involving the central stalk subunits. This protein is a component of the F(0) channel and part of the peripheral stalk, linking F(1) and F(0).
Protein Families
ATPase B chain family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Single-pass membrane protein.

Q&A

What is Welwitschia mirabilis and why is its ATP synthase of research interest?

Welwitschia mirabilis is an ancient, enigmatic gymnosperm belonging to the gnetophyte lineage, characterized by extreme longevity and a unique biology featuring two ever-elongating leaves. It has survived in the harsh Namib Desert environment for millions of years . The ATP synthase components of this plant are of particular interest because they may reveal adaptive mechanisms that enable energy production under extreme environmental conditions. The chloroplastic ATP synthase subunit b (atpF) functions as part of the F0 sector of ATP synthase, which is crucial for the final step of photosynthetic ATP production - a process that has likely evolved specialized characteristics in this desert-adapted plant .

How does the atpF protein function within the ATP synthase complex?

The atpF protein (ATP synthase subunit b) is a critical component of the ATP synthase stator, which anchors the catalytic portion (F1) to the membrane-embedded portion (F0). In chloroplasts, ATP synthase uses the transmembrane proton gradient generated during photosynthesis to synthesize ATP from ADP and inorganic phosphate.

The subunit b forms part of the peripheral stalk that prevents the F1 portion from rotating with the central rotor during ATP synthesis. This stabilization is essential for the rotary mechanism of ATP synthesis, where the central rotor turns approximately 150 times per second during active ATP production . The unique adaptations in Welwitschia's atpF may contribute to maintaining ATP synthesis efficiency under extreme desert conditions with high temperatures and limited water availability.

How might the unusual methylation patterns in Welwitschia affect the expression and function of chloroplast genes like atpF?

Welwitschia mirabilis exhibits exceptionally high levels of cytosine methylation compared to other plants, particularly in the CHH context (where H represents A, T, or C). While most angiosperms show CHH methylation levels below 10% and gymnosperms like Picea abies around 1.5%, Welwitschia demonstrates an extraordinary 35.7% average methylation level in CHH contexts . This unusually high methylation may influence chloroplast gene expression, including atpF.

Research methodology to investigate this connection should include:

  • Comparative methylome analysis of nuclear and chloroplast genomes

  • Correlation of methylation patterns with atpF expression levels using RT-qPCR

  • Investigation of transcription factor binding to methylated vs. unmethylated regions

  • Analysis of protein expression levels and post-translational modifications

The high methylation, particularly in transposable elements (89% of differentially methylated regions), suggests epigenetic regulation may play a role in the adaptive expression of energy metabolism genes like atpF under desert stress conditions .

What structural and functional adaptations might exist in the Welwitschia atpF protein that contribute to photosynthetic efficiency in desert conditions?

Welwitschia mirabilis has evolved to photosynthesize efficiently under extreme desert conditions. Research into its atpF protein may reveal adaptations that enhance ATP synthase stability and function under high temperatures, UV radiation, and water limitation.

Investigation methodologies should include:

  • Comparative structural analysis between Welwitschia atpF and homologs from non-desert plants

  • Thermal stability assays of recombinant atpF protein at various temperatures

  • Site-directed mutagenesis to identify key residues contributing to desert adaptation

  • In vitro reconstitution of ATP synthase complexes with Welwitschia atpF to measure functional parameters

Studies have shown that Welwitschia's photosynthetic efficiency varies spatially and temporally across different catchments, suggesting environmental adaptation at the physiological level . The chlorophyll a fluorescence technique can be employed to assess photosynthetic efficiency as an indicator of ATP synthase function under varying conditions.

How does the exceptionally GC-poor genome of Welwitschia impact the codon usage and evolutionary conservation of the atpF gene?

Welwitschia mirabilis possesses an unusually GC-poor genome (~29.07%), among the lowest reported in plants . This characteristic likely influences codon usage bias and evolutionary rates of chloroplast genes like atpF.

Research approaches should include:

  • Codon usage analysis of atpF compared to homologs in GC-rich plant genomes

  • Evaluation of translational efficiency using ribosome profiling

  • Molecular evolutionary analyses to detect selection signatures

  • Comparative transcriptomics to identify compensatory mechanisms for low GC content

The evolutionary impact of low GC content may be investigated by examining synonymous substitution rates and codon adaptation indices. The unusually high methylation levels in conjunction with low GC content present a unique genomic environment that may have driven novel adaptations in energy metabolism genes like atpF .

What are the optimal conditions for expression and purification of recombinant Welwitschia mirabilis atpF protein?

Optimal expression and purification of recombinant Welwitschia mirabilis ATP synthase subunit b involves several critical considerations:

Expression System:

  • E. coli is the established expression system for this protein

  • Full-length protein (1-182 amino acids) with N-terminal His-tag has been successfully expressed

Expression Conditions:

  • Induction: IPTG concentration typically 0.5-1.0 mM

  • Temperature: Lower temperatures (16-25°C) often improve folding of membrane-associated proteins

  • Duration: 4-16 hours, depending on temperature

Purification Protocol:

  • Cell lysis using sonication or pressure-based methods in Tris/PBS-based buffer

  • Immobilized metal affinity chromatography (IMAC) using Ni-NTA resin

  • Washing with increasing imidazole concentrations (10-40 mM)

  • Elution with higher imidazole (200-300 mM)

  • Buffer exchange to remove imidazole

  • Optional secondary purification via size exclusion chromatography

Storage Considerations:

  • Store in Tris/PBS-based buffer, pH 8.0 with 6% trehalose

  • For long-term storage, add glycerol to 5-50% final concentration (50% recommended)

  • Aliquot and store at -20°C/-80°C to avoid freeze-thaw cycles

  • For working stocks, store at 4°C for up to one week

Reconstitution Protocol:

  • Reconstitute lyophilized protein in deionized sterile water

  • Recommended concentration: 0.1-1.0 mg/mL

What methods can be used to assess the functional activity of recombinant Welwitschia atpF protein in vitro?

Several complementary methods can be employed to evaluate the functional activity of recombinant Welwitschia mirabilis atpF protein:

Membrane Reconstitution Assays:

  • Reconstitution into liposomes with other ATP synthase components

  • Measurement of proton translocation using pH-sensitive fluorescent dyes

  • ATP synthesis activity measurement using luciferase-based ATP detection

Protein-Protein Interaction Studies:

  • Co-immunoprecipitation with other ATP synthase subunits

  • Surface plasmon resonance to measure binding kinetics and affinities

  • Cross-linking studies to identify interaction domains

Structural Integrity Assessment:

  • Circular dichroism spectroscopy to analyze secondary structure

  • Thermal shift assays to measure protein stability

  • Limited proteolysis to assess folding status

Functional Complementation:

  • Reconstitution of ATP synthase complexes with and without Welwitschia atpF

  • Comparison of ATP synthesis rates between reconstituted complexes

  • Measurement of proton conductance in the presence and absence of inhibitors

These methods should be calibrated against known standards, such as equivalent ATP synthase components from model organisms, to enable comparative analysis of the unique properties of the Welwitschia protein.

How can chlorophyll a fluorescence techniques be applied to study the performance of ATP synthase in Welwitschia mirabilis?

Chlorophyll a fluorescence provides valuable insights into photosynthetic efficiency, which is directly related to ATP synthase function. For Welwitschia mirabilis research:

Fast Chlorophyll a Fluorescence Induction (OJIP Test):

Key Parameters to Measure:

  • Absorption of light energy (ABS)

  • Trapping of excitation energy (TR)

  • Conversion of excitation energy to electron transport (ET)

  • Probability to reduce end electron acceptors (for PItotal)

Experimental Design Considerations:

  • Compare plants from different microhabitats to assess environmental adaptation

  • Measure at different times of day and seasons to capture temporal patterns

  • Control for leaf age, as Welwitschia has continually growing leaves that may show position-dependent variation

  • Correlate fluorescence data with environmental parameters (temperature, humidity, soil moisture)

Interpretation in Relation to ATP Synthase:

  • Reduced electron transport rate may indicate limitations in ATP synthase activity

  • Changes in the performance index (PI) can reflect ATP synthase adaptation to stress

  • Temporal patterns may reveal regulatory mechanisms of energy conversion efficiency

This non-destructive technique is particularly valuable for field studies of this protected species and can be combined with laboratory analyses of the recombinant atpF protein to establish structure-function relationships.

What bioinformatic approaches are most effective for analyzing the evolutionary conservation of Welwitschia mirabilis atpF compared to other gymnosperms?

To analyze evolutionary conservation of Welwitschia mirabilis atpF, several bioinformatic approaches are recommended:

Sequence-Based Analysis:

  • Multiple sequence alignment with homologs from diverse gymnosperm lineages

  • Calculation of sequence identity/similarity percentages across:

    • Gnetophytes (Welwitschia's closest relatives)

    • Conifers (more distant gymnosperms)

    • Angiosperms (as outgroups)

  • Identification of conserved motifs and functional domains using tools like MEME and Pfam

Phylogenetic Analysis:

  • Construction of maximum likelihood and Bayesian trees to resolve evolutionary relationships

  • Estimation of divergence times using calibrated molecular clocks

  • Reconciliation of gene trees with species trees to identify duplication/loss events

Selection Pressure Analysis:

  • Calculation of dN/dS ratios to detect selective pressure

  • Branch-site models to identify lineage-specific selection

  • Mixed effects likelihood approach to identify specific sites under selection

Structural Prediction and Comparison:

  • Homology modeling of 3D structure

  • Superimposition of predicted structures to identify conserved structural elements

  • Analysis of surface electrostatic potential to identify functional conservation

Given Welwitschia's ancient whole-genome duplication (~86 million years ago) , special attention should be paid to paralogous sequences that may have undergone functional divergence or subfunctionalization.

How does the physiological health of Welwitschia mirabilis plants correlate with ATP synthase activity across different environmental conditions?

The correlation between physiological health and ATP synthase activity in Welwitschia can be assessed through an integrated research approach:

Field Measurements:

Physiological Health Indicators Table:

Correlation Analysis:

  • Spatial analysis comparing plants across different catchments/microhabitats

  • Temporal analysis tracking seasonal changes and responses to precipitation events

  • Statistical modeling to identify environmental thresholds affecting ATP synthase function

Research has shown that Welwitschia plants exhibit clear differences in photosynthetic efficiency across different catchments, with notable responses to episodic rainfall events . This suggests that ATP synthase activity likely varies with environmental conditions, potentially through adaptive regulatory mechanisms that have evolved in this extreme desert specialist.

What are the potential applications of understanding the unique properties of Welwitschia mirabilis atpF for engineering stress-tolerant crops?

Understanding the unique properties of Welwitschia mirabilis atpF could contribute significantly to engineering stress-tolerant crops through several potential applications:

Knowledge Transfer Pathways:

  • Enhancement of Photosynthetic Efficiency Under Stress:

    • Identification of structural adaptations in atpF that maintain ATP synthesis under high temperatures

    • Engineering crop ATP synthase components with similar heat-stable properties

    • Optimization of proton gradient utilization under drought conditions

  • Improved Energy Management During Stress:

    • Understanding regulatory mechanisms that balance ATP production during water limitation

    • Implementing similar energy conservation strategies in crop plants

    • Engineering feedback mechanisms that prioritize essential functions during stress

  • Epigenetic Regulation of Energy Metabolism:

    • Application of knowledge about methylation patterns affecting energy metabolism genes

    • Development of epigenetic editing approaches to enhance stress tolerance

    • Creation of crop varieties with environmentally responsive regulatory mechanisms

Potential Applications Table:

Welwitschia FeatureResearch ApproachCrop Engineering Application
Thermal stability of atpFStructure-function analysis through mutagenesisHeat-tolerant ATP synthase variants for crops
Drought adaptation mechanismsFunctional analysis under controlled water limitationImproved water-use efficiency in photosynthesis
Epigenetic regulationMethylome analysis and correlation with gene expressionEpigenetic editing for enhanced stress response
Longevity mechanismsAnalysis of protein turnover and repair mechanismsExtended functional lifespan of photosynthetic machinery

The extreme adaptations of Welwitschia, which has survived in the harsh Namib Desert for millions of years, potentially offer valuable insights for developing crops that can maintain productivity under increasingly challenging climatic conditions .

What are the common challenges in working with recombinant Welwitschia mirabilis atpF protein and how can they be addressed?

Researchers working with recombinant Welwitschia mirabilis atpF protein commonly encounter several challenges that can be systematically addressed:

Challenge 1: Protein Solubility Issues

  • Problem: As a membrane-associated protein, atpF may have limited solubility

  • Solutions:

    • Use mild detergents (0.1-1% DDM, CHAPS, or Triton X-100) during purification

    • Express as fusion protein with solubility enhancers (MBP, SUMO, or thioredoxin)

    • Optimize buffer conditions (pH, salt concentration, additives like glycerol)

    • Consider native purification conditions to maintain folding

Challenge 2: Expression Level Optimization

  • Problem: Low expression yields in heterologous systems

  • Solutions:

    • Codon optimization for E. coli expression

    • Test different E. coli strains (BL21(DE3), Rosetta, C41/C43)

    • Optimize induction conditions (temperature, IPTG concentration, duration)

    • Use auto-induction media for gradual protein expression

Challenge 3: Functional Activity Assessment

  • Problem: Difficulty in measuring activity of isolated subunit

  • Solutions:

    • Co-express with interaction partners

    • Reconstitute with other ATP synthase components in vitro

    • Develop partial activity assays focusing on specific functions like binding

Challenge 4: Protein Stability During Storage

  • Problem: Loss of activity during storage

  • Solutions:

    • Add stabilizing agents (trehalose, glycerol) to storage buffer

    • Aliquot to avoid freeze-thaw cycles

    • Consider lyophilization for long-term storage

    • Monitor protein quality regularly with activity assays

Addressing these challenges requires systematic optimization and careful documentation of conditions that affect protein yield, solubility, and activity.

How can researchers interpret conflicting data when comparing in vitro studies of recombinant atpF with in vivo measurements of photosynthetic efficiency?

When confronted with discrepancies between in vitro recombinant protein studies and in vivo measurements, researchers should consider several factors:

Sources of Discrepancy:

  • Protein Context Differences

    • In vivo: atpF functions within complete ATP synthase complex

    • In vitro: Isolated protein may lack critical interaction partners

    • Resolution: Progressively reconstitute with partner proteins to bridge the gap

  • Post-translational Modifications

    • In vivo: Proteins may have specific modifications affecting function

    • In vitro: Recombinant proteins often lack native modifications

    • Resolution: Analyze native protein for modifications; engineer modifications into recombinant version

  • Environmental Conditions

    • In vivo: Complex, fluctuating conditions including spatial and temporal variation

    • In vitro: Simplified, controlled conditions

    • Resolution: Systematically vary in vitro conditions to better mimic natural environment

Reconciliation Framework:

ParameterIn Vitro ApproachIn Vivo ApproachIntegration Strategy
Structural PropertiesBiophysical characterizationFluorescence lifetime imagingCorrelate structural parameters with in vivo function
Activity MeasurementsReconstituted systemsChlorophyll fluorescenceDesign in vitro conditions based on in vivo measurements
Environmental ResponseControlled variable testingField measurements across conditionsCreate environmental response curves from both datasets
Temporal DynamicsRapid kinetic measurementsSeasonal and diurnal monitoringMatch timescales when comparing data

Interpretation Guidelines:

  • Establish clear expectations for agreement/disagreement between methods

  • Consider multiple hypotheses for observed discrepancies

  • Design targeted experiments to test specific mechanistic explanations

  • Use mathematical modeling to integrate diverse data types

By systematically addressing discrepancies, researchers can develop a more complete understanding of how molecular properties translate to ecological performance in this unique desert specialist.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.