Recombinant Welwitschia mirabilis Cytochrome b6 (petB)

Shipped with Ice Packs
In Stock

Description

Expression Systems

Two primary methods are used for production:

  1. Prokaryotic Expression:

    • Host: Escherichia coli

    • Yield: High (mg/L scale)

    • Tag: N-terminal His tag for affinity chromatography

  2. Eukaryotic Expression:

    • Host: Mammalian cell lines

    • Advantages: Proper post-translational modifications

    • Purity: >85% (SDS-PAGE verified)

Functional Insights

Cytochrome b6 (petB) functions within the cytochrome b6-f complex to mediate electron transfer and proton gradient generation. Key findings include:

  • Evolutionary Conservation: Despite gene loss in some lineages (e.g., angiosperms), Welwitschia mirabilis retains petB with 177–215 amino acids, reflecting ancestral traits .

  • RNA Editing: Plastid genomes of Welwitschia show complete loss of RNA editing in petB, suggesting a unique evolutionary trajectory .

Comparative Studies

  • Phylogenetic Analysis: petB sequences from Welwitschia cluster with non-angiosperm species, supporting its basal position in plant evolution .

  • Structural Biology: Recombinant petB is used for crystallography to map electron transport pathways .

Experimental Use Cases

ApplicationDetails
Enzyme KineticsKinetic parameters of electron transfer
Antibody ProductionImmunogen for raising anti-cytochrome b6 antibodies
Mutagenesis StudiesRole of conserved residues in heme binding

Key Research Findings

  • Gene Structure: The petB gene in Welwitschia mirabilis lacks introns, unlike homologs in bryophytes .

  • Conserved Motifs: Seven motifs (e.g., E-K-F/Y-A-R-Q-Q, H-D-A-D-W-F) are critical for redox activity .

  • Evolutionary Divergence: Accelerated substitution rates in petB correlate with plastome compaction in Welwitschia .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we have in stock. However, if you have a specific format requirement, please indicate it when placing the order, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributor for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please contact us in advance, as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal use, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers may use this as a reference.
Shelf Life
The shelf life depends on multiple factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
petB; Cytochrome b6
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-215
Protein Length
full length protein
Species
Welwitschia mirabilis (Tree tumbo) (Welwitschia bainesii)
Target Names
petB
Target Protein Sequence
MGKVYDWFEERLEIQAIADDITSKYVPPHVNIFYCLGGITLTCFLVQVATGFAMTFYYRP TVTEAFASVQYIMVEVNFGWLIRSIHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT GVILAVLTVSFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSFSVGQSTL TRFYSLHTFILPFLTAVFMLMHFLMIRKQGISGPL
Uniprot No.

Target Background

Function
Cytochrome b6 is a component of the cytochrome b6-f complex, which facilitates electron transfer between photosystem II (PSII) and photosystem I (PSI), cyclic electron flow around PSI, and state transitions.
Protein Families
Cytochrome b family, PetB subfamily
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is Welwitschia mirabilis and why is it significant for cytochrome studies?

Welwitschia mirabilis is the only extant member of the family Welwitschiaceae, belonging to one of three lineages of gnetophytes, an enigmatic group of gymnosperms that has been variously allied with flowering plants or conifers in evolutionary studies. The significance of W. mirabilis in cytochrome research stems from its unique evolutionary position and unusual genomic properties.

The chloroplast genome of Welwitschia mirabilis (GenBank: EU342371) consists of 119,726 base pairs and displays the typical quadripartite structure found in most land plants, with large single copy (LSC) and small single copy (SSC) regions separated by two inverted repeats (IR) . Notably, Welwitschia possesses the smallest plastid genome of any published non-parasitic land plant that still retains the large IR, making it an interesting model for studying the evolution and function of photosynthetic proteins, including cytochromes .

Molecular phylogenetic analyses based on 57 concatenated protein-coding sequences have alternately placed Welwitschia at the base of all seed plants or as a sister to conifers (represented by Pinus) in a monophyletic gymnosperm clade, depending on the analytical method employed . Additionally, relative rate tests have shown that Welwitschia sequences evolve at faster rates than other seed plants, adding another layer of interest for comparative cytochrome studies .

What is the structure and function of the petB gene product in photosynthetic organisms?

The petB gene encodes the cytochrome b6 subunit of the cytochrome b6f complex, a crucial component of the photosynthetic electron transport chain. Based on comparative analysis with other photosynthetic organisms, the petB gene typically consists of a coding region of approximately 650-670 nucleotides, encoding a polypeptide with a molecular mass of around 25 kDa .

The cytochrome b6 protein functions as an electron carrier within the cytochrome b6f complex, which mediates electron transfer between photosystem II and photosystem I in oxygenic photosynthesis. This protein contains multiple transmembrane helices and binds heme groups that facilitate the electron transfer process.

In cyanobacteria such as Synechocystis sp. PCC 6803, the petB gene encodes a protein with an amino-terminal extension of seven amino acids compared to higher plants . Post-translational processing, including the removal of three amino acids from the amino terminus, has been observed in some species . While this specific information comes from cyanobacterial studies, it provides a framework for understanding potential processing in Welwitschia's cytochrome b6.

How should researchers prepare recombinant W. mirabilis cytochrome b6 samples for experimental use?

Proper preparation of recombinant W. mirabilis cytochrome b6 samples is critical for experimental success. Based on established protocols for similar recombinant proteins, researchers should follow these methodological steps:

  • Reconstitution Protocol:

    • Centrifuge the vial briefly before opening to bring contents to the bottom

    • Reconstitute the lyophilized protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL

    • Add glycerol to a final concentration of 5-50% (with 50% being optimal for most applications)

    • Aliquot for long-term storage at -20°C/-80°C

  • Storage Considerations:

    • Avoid repeated freeze-thaw cycles, which can compromise protein integrity

    • Store working aliquots at 4°C for no more than one week

    • For long-term storage, maintain at -20°C/-80°C in storage buffer (typically Tris/PBS-based buffer with 6% trehalose, pH 8.0)

  • Quality Control Assessments:

    • Verify protein purity (should be greater than 90% as determined by SDS-PAGE)

    • Confirm protein identity via mass spectrometry or amino acid sequencing

    • Test functional activity using appropriate electron transport assays

What expression systems are most effective for producing recombinant W. mirabilis cytochrome b6?

Based on comparative studies with related proteins, E. coli expression systems have proven effective for the production of recombinant photosynthetic proteins, including those from non-model organisms like Welwitschia. The methodological approach typically involves:

  • Vector Design:

    • Codon optimization for E. coli expression

    • Addition of a His-tag (typically N-terminal) to facilitate purification

    • Inclusion of appropriate promoter systems (T7 promoter systems are commonly used)

  • Expression Conditions:

    • Induction with IPTG at reduced temperatures (16-18°C) to enhance proper folding

    • Extended expression times (18-24 hours) to maximize yield

    • Supplementation with δ-aminolevulinic acid to enhance heme incorporation

  • Cell Lysis and Initial Purification:

    • Gentle lysis using combinations of enzymatic and mechanical methods

    • Inclusion of protease inhibitors to prevent degradation

    • Sequential centrifugation steps to remove cellular debris

For comparison, the recombinant cytochrome b6f complex subunit 4 (petD) from W. mirabilis has been successfully expressed in E. coli with an N-terminal His-tag, suggesting similar approaches may be effective for petB .

How do evolutionary patterns in the petB gene of W. mirabilis compare to other photosynthetic organisms?

The evolutionary patterns of the petB gene in Welwitschia mirabilis display several distinctive features compared to other photosynthetic organisms. Rigorous comparative genomic analysis reveals:

Organism GrouppetB Gene Length (approx.)Notable FeaturesEvolutionary Rate
Welwitschia mirabilis650-670 bpCompact genome organizationAccelerated (1.5-3× faster)
Other Gymnosperms650-680 bpStandard organizationBaseline
Angiosperms650-690 bpOften contains intronsBaseline to moderately fast
Cyanobacteria660-670 bpN-terminal extensionVariable

The Welwitschia plastome exhibits at least 9 inversions that modify gene order compared to other seed plants, which may affect the regulatory context of the petB gene . Additionally, relative rate tests on protein-coding sequences show that Welwitschia sequences evolve at faster rates than other seed plants, with divergence ranging from amounts approximately equal to other seed plants to amounts almost three times greater .

This accelerated evolution may have functional implications for the cytochrome b6 protein, potentially affecting:

  • Protein-protein interaction surfaces

  • Electron transfer efficiency

  • Stability under heat stress (relevant given Welwitschia's desert habitat)

  • Post-translational modification patterns

Researchers studying W. mirabilis cytochrome b6 should consider these evolutionary patterns when designing comparative studies or when interpreting functional differences between Welwitschia and other model organisms.

What methodological approaches should be used to assess functional activity of recombinant W. mirabilis cytochrome b6?

Assessing the functional activity of recombinant W. mirabilis cytochrome b6 requires sophisticated methodological approaches that address both its redox properties and its integration into electron transport systems:

  • Spectroscopic Analysis:

    • UV-visible spectroscopy to determine characteristic absorption peaks (typical peaks at around 430 nm (Soret band) and 550-560 nm (α-band))

    • Circular dichroism to assess secondary structure integrity

    • Electron paramagnetic resonance (EPR) to examine heme environment

  • Redox Potential Measurements:

    • Potentiometric titrations using redox mediators

    • Protein film voltammetry on modified electrodes

    • Comparative analysis with native cytochrome b6 when available

  • Electron Transfer Kinetics:

    • Stopped-flow spectroscopy with artificial electron donors/acceptors

    • Laser flash photolysis for rapid kinetics

    • Reconstitution into liposomes with other components of the electron transport chain

  • Structural Validation:

    • Limited proteolysis to assess correct folding

    • Thermal shift assays to determine stability

    • Binding studies with known interaction partners (e.g., plastocyanin, ferredoxin)

When performing comparative studies between different recombinant preparations or between recombinant and native proteins, researchers should implement batch correction methods to minimize systematic variations. Both ComBat and Limma statistical methods have proven effective in reducing batch effects in comparative biological data, as they adjust for both location and scale parameters across batches .

How can researchers overcome expression and purification challenges for recombinant W. mirabilis cytochrome b6?

Expression and purification of membrane-associated electron transport proteins like cytochrome b6 present significant challenges. Based on experimental experience with similar proteins, researchers should consider these methodological approaches:

  • Expression Optimization:

    • Test multiple fusion tags beyond standard His-tags (e.g., MBP, SUMO, or GST fusions)

    • Employ specialized E. coli strains designed for membrane protein expression (e.g., C41(DE3), C43(DE3))

    • Implement auto-induction media formulations to achieve gradual protein expression

    • Consider cell-free expression systems for difficult-to-express variants

  • Membrane Extraction Strategies:

    • Systematic detergent screening (start with mild detergents like DDM, LMNG, or digitonin)

    • Utilize detergent-lipid mixtures to maintain native-like environments

    • Implement stepwise solubilization protocols with increasing detergent concentrations

    • Consider amphipol or nanodisc technologies for maintaining protein stability post-purification

  • Chromatographic Purification Cascade:

    • Initial capture using immobilized metal affinity chromatography (IMAC)

    • Secondary purification via ion exchange chromatography

    • Polishing step using size exclusion chromatography in appropriate detergent/buffer systems

    • Quality assessment at each stage using spectroscopic techniques to monitor heme incorporation

  • Functional Reconstitution:

    • Screen various lipid compositions for proteoliposome reconstitution

    • Optimize protein-to-lipid ratios for functional studies

    • Validate orientation in proteoliposomes using protease protection assays

    • Confirm electron transfer functionality using artificial electron donors/acceptors

The purification should aim for >90% purity as determined by SDS-PAGE, similar to standards established for related recombinant proteins .

What biophysical techniques are most informative for comparing native and recombinant W. mirabilis cytochrome b6?

To rigorously compare native and recombinant forms of Welwitschia mirabilis cytochrome b6, researchers should employ multiple complementary biophysical techniques:

  • High-Resolution Structural Analysis:

    • X-ray crystallography (if crystals can be obtained)

    • Cryo-electron microscopy for structure determination without crystallization

    • Nuclear magnetic resonance (NMR) for dynamic regions and ligand interactions

    • Hydrogen-deuterium exchange mass spectrometry (HDX-MS) to probe conformational dynamics

  • Spectroscopic Comparison:

    • Resonance Raman spectroscopy to examine heme environment and axial ligands

    • Multi-wavelength circular dichroism to assess secondary structure elements

    • Fluorescence spectroscopy to examine tryptophan environments and protein folding

    • Fourier-transform infrared spectroscopy (FTIR) for secondary structure analysis

  • Thermodynamic and Kinetic Profiling:

    • Isothermal titration calorimetry (ITC) for binding energetics

    • Differential scanning calorimetry (DSC) for thermal stability comparison

    • Surface plasmon resonance (SPR) for interaction kinetics with partner proteins

    • Microscale thermophoresis for affinity measurements in near-native conditions

  • Functional Comparative Assays:

    • Oxygen consumption measurements in reconstituted systems

    • NADP+ reduction kinetics when coupled with appropriate partners

    • Superoxide production rates to assess uncoupling reactions

    • Electron paramagnetic resonance (EPR) for detecting reactive intermediates

When analyzing data from these diverse techniques, researchers should employ robust statistical methods to account for batch effects. Both ComBat and Limma methods have proven effective for this purpose, with no significant difference observed between the two approaches in terms of their ability to reduce systematic variations .

How can computational approaches enhance understanding of W. mirabilis cytochrome b6 structure-function relationships?

Computational approaches offer powerful tools for investigating structure-function relationships in W. mirabilis cytochrome b6, particularly given the challenges of experimental work with this unique protein:

  • Homology Modeling and Refinement:

    • Generate initial models based on crystal structures of cytochrome b6 from other species

    • Refine models using molecular dynamics simulations in membrane environments

    • Validate models through comparison with experimental spectroscopic data

    • Identify potential regions of structural divergence from model organisms

  • Molecular Dynamics Simulations:

    • Simulate protein behavior in various membrane compositions

    • Examine conformational changes during electron transfer events

    • Investigate water and proton pathways within the protein

    • Assess the impact of Welwitschia-specific amino acid substitutions on protein dynamics

  • Quantum Mechanical/Molecular Mechanical (QM/MM) Calculations:

    • Model electron transfer pathways and energetics

    • Calculate redox potentials of heme groups

    • Investigate transition states during catalytic events

    • Compare calculated spectroscopic properties with experimental measurements

  • Network Analysis and Evolutionary Coupling:

    • Identify co-evolving residues across cytochrome b6 sequences

    • Map evolutionary constraints onto structural models

    • Predict functional interfaces based on conservation patterns

    • Integrate data from accelerated evolutionary rates observed in Welwitschia

  • Machine Learning Applications:

    • Develop predictive models for protein-protein interaction specificity

    • Identify patterns in sequence-structure-function relationships across species

    • Optimize expression and purification conditions based on protein properties

    • Predict the impact of site-directed mutations on protein stability and function

These computational approaches can help bridge gaps in experimental data and provide testable hypotheses about the unique properties of W. mirabilis cytochrome b6, particularly in the context of its unusual evolutionary history and the accelerated evolutionary rates observed in Welwitschia protein-coding genes .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.