Recombinant Welwitschia mirabilis Photosystem I assembly protein Ycf4 (ycf4)

Shipped with Ice Packs
In Stock

Description

Introduction

Welwitschia mirabilis is a unique gymnosperm endemic to the Namib Desert, known for its exceptional longevity and distinctive morphology . The ycf4 gene, encoding the "hypothetical chloroplast reading frame no. 4" protein, plays a crucial role in the biogenesis of Photosystem I (PSI) in photosynthetic organisms . Specifically, Ycf4 is essential for the accumulation of PSI, a large protein complex in the thylakoid membrane responsible for light-dependent electron transfer .

Genomic Context of Welwitschia mirabilis

The plastid genome of Welwitschia mirabilis is compact, spanning 119,726 base pairs . It features a large single copy region (LSC) of 68,556 bp and a small single copy region (SSC) of 11,156 bp, separated by two copies of a large inverted repeat (IR) of 20,007 bp each . This genome encodes 101 distinct genes, including 31 tRNA genes, four rRNA gene species, and 66 protein-coding genes, some of which are duplicated in the IR regions . The Welwitschia plastome exhibits several inversions that modify gene order, along with instances of gene loss or pseudogenization .

Function of Ycf4 in Photosystem I Assembly

Ycf4 is vital for the biogenesis of PSI, a process involving the coordinated assembly of nucleus-encoded and chloroplast-encoded protein subunits, along with the insertion of various cofactors such as chlorophylls, carotenoids, and iron-sulfur clusters . Research indicates that Ycf4 is involved in an early step of PSI assembly, directly mediating interactions between newly synthesized PSI polypeptides and aiding in the assembly of the PSI complex .

Ycf4-containing Complex

Biochemical studies have identified a large Ycf4-containing complex with a size exceeding 1500 kD . This complex includes the opsin-related COP2 protein and PSI subunits PsaA, PsaB, PsaC, PsaD, PsaE, and PsaF . The intimate association of Ycf4 and COP2 suggests their functional relationship .

Evolution and Heterodimerization of Photosystem I

PSI in cyanobacteria is heterodimeric, consisting of two homologous core subunits, PsaA and PsaB . It is proposed that the heterodimerization of PSI occurred as an evolutionary adaptation to the presence of oxygen, allowing for fine-tuning of redox cofactors to minimize the formation of reactive oxygen species .

Absence of Key Photosynthesis Genes in Welwitschia mirabilis

The Welwitschia plastome is missing several genes typically found in land plant chloroplast genomes, including chlL, chlN, and chlB, which encode subunits of protochlorophyllide reductase . The absence or pseudogenization of these genes suggests an adaptation in chlorophyll biosynthesis pathways in Welwitschia .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
ycf4; Photosystem I assembly protein Ycf4
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-185
Protein Length
full length protein
Species
Welwitschia mirabilis (Tree tumbo) (Welwitschia bainesii)
Target Names
ycf4
Target Protein Sequence
MNNQSKRLWIEPIQGSRRKSNFFFASILFGGALGFFLVGFSSYLGRNLLPLLSSQQIIFV PQGIVMCFYGIAGLFFSSYLWCTIFFNVGSGYNQIDEKTGIVCLFRWGFPGRNRRIFLRF PLKNVHMIKMEVQENLFSSRHILYMKVKGLPDIPLARTGENLNLKEMEQKAAELARFLHV SIEGF
Uniprot No.

Target Background

Function
Essential for the assembly of the photosystem I complex.
Protein Families
Ycf4 family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is the Ycf4 protein and what is its function in Welwitschia mirabilis?

The Photosystem I assembly protein Ycf4 in Welwitschia mirabilis is a thylakoid membrane protein essential for the accumulation and assembly of Photosystem I (PSI) complexes. Studies in other organisms such as Chlamydomonas reinhardtii have demonstrated that Ycf4 forms a large complex that acts as a scaffold for PSI assembly by mediating interactions between newly synthesized PSI polypeptides . In Welwitschia, the protein is encoded in the chloroplast genome, which has been fully sequenced, revealing unique adaptations in this ancient gymnosperm .

How is the ycf4 gene organized in the Welwitschia mirabilis chloroplast genome?

In Welwitschia mirabilis, the ycf4 gene is located in the chloroplast genome, which is 119,726 bp in size and consists of a large single copy region (LSC) of 68,556 bp and a small single copy region (SSC) of 11,156 bp, separated by two copies of the large inverted repeat of 20,007 bp each . Based on studies in other species like Chlamydomonas reinhardtii, the ycf4 gene is typically found within a polycistronic transcriptional unit that may include genes such as rps9, ycf3, and rps18 .

What are the recommended protocols for purifying recombinant Welwitschia mirabilis Ycf4 protein for functional studies?

For purification of recombinant Welwitschia mirabilis Ycf4 protein, researchers should implement a two-step affinity chromatography approach similar to that used for Chlamydomonas Ycf4:

  • Initial preparation: Express the recombinant protein with an appropriate tag (typically TAP-tag containing calmodulin binding peptide and Protein A domains).

  • Membrane solubilization: Extract thylakoid membranes and solubilize with n-dodecyl-β-D-maltoside (DDM).

  • First affinity step: Utilize IgG agarose column chromatography with overnight incubation at 4°C in a rotating column to ensure efficient adsorption.

  • Elution and second affinity step: Cleave the protein using tobacco etch virus protease followed by a second affinity chromatography step.

  • Storage: Maintain in a Tris-based buffer with 50% glycerol at -20°C, with working aliquots at 4°C for up to one week .

This methodology ensures high purification levels while maintaining the protein's native structure and function.

How can researchers effectively assess the functional integrity of purified recombinant Ycf4 protein?

To verify the functional integrity of purified recombinant Welwitschia mirabilis Ycf4:

  • Complex formation analysis: Use sucrose gradient ultracentrifugation followed by ion exchange chromatography to confirm formation of the large Ycf4-containing complex (>1500 kD).

  • Protein interaction studies: Employ co-immunoprecipitation or pull-down assays to verify interactions with PSI subunits (PsaA, PsaB, PsaC, PsaD, PsaE, and PsaF).

  • Structural confirmation: Utilize transmission electron microscopy and single particle analysis to visualize the complex (structures approximately 285 × 185 Å).

  • Functional complementation: Perform complementation studies in Ycf4-deficient mutants to assess rescue of PSI assembly.

  • Chlorophyll fluorescence measurements: Employ the JIP-test to evaluate photochemical potential and PSI activity in vivo .

These approaches collectively provide comprehensive assessment of both structural integrity and functional capacity of the recombinant protein.

How should experimental conditions be optimized when studying the interactions between Ycf4 and PSI subunits in Welwitschia mirabilis?

When investigating Ycf4-PSI subunit interactions in Welwitschia mirabilis:

  • Buffer optimization: Use buffers containing 20 mM HEPES-KOH (pH 7.5), 10 mM MgCl₂, 80 mM KCl, and 0.2% DDM to maintain complex stability.

  • Salt sensitivity testing: Evaluate complex stability under varying ionic conditions, as salt sensitivity has been observed in related complexes.

  • Protein labeling strategies: Implement pulse-chase protein labeling with radioactive amino acids to track newly synthesized PSI polypeptides associated with the Ycf4 complex.

  • Temperature considerations: Conduct interaction studies at lower temperatures (4°C) to preserve complex integrity.

  • Cross-linking approaches: Utilize reversible cross-linking agents to stabilize transient interactions before analysis .

These optimizations are crucial for capturing authentic interaction dynamics, particularly given the unique evolutionary position of Welwitschia mirabilis.

How does the structure and function of Ycf4 in Welwitschia mirabilis compare with that in other gymnosperms and model organisms?

Comparative analysis of Ycf4 across species reveals:

  • Sequence conservation: Welwitschia mirabilis Ycf4 shares core functional domains with other plant Ycf4 proteins but exhibits unique features reflecting its evolutionary position.

  • Functional divergence: Unlike cyanobacterial Ycf4 mutants that can still assemble PSI at reduced levels, Ycf4 in Chlamydomonas and likely in Welwitschia is essential for PSI accumulation.

  • Complex formation: The Welwitschia Ycf4 complex is predicted to contain additional components compared to algal counterparts, possibly reflecting adaptation to extreme desert conditions.

  • Evolutionary rate analysis: Relative rate tests on plastid genes indicate that Welwitschia sequences are evolving at faster rates than other seed plants, with pairwise distance comparisons showing divergence rates up to three times greater than non-gnetophyte seed plants, as shown in the following comparative data :

Comparison(WEMI, Pinus) Ginkgo(WEMI, Ginkgo) Pinus(WEMI, Amborella) Ginkgo
Unique differences WEMI545654565088
Unique differences Seq B161518053220
Unique differences Seq C180516151955
χ² statistic2086.451835.81420.1
P value (1 df)0.000000.000000.00000

This accelerated evolution may have implications for Ycf4 function in this ancient gymnosperm .

What insights can Welwitschia mirabilis Ycf4 provide about the evolution of photosynthesis in gymnosperms?

The study of Welwitschia mirabilis Ycf4 offers several evolutionary insights:

  • Ancient divergence: Phylogenetic analyses place Welwitschia at the base of all seed plants or as sister to conifers within a monophyletic gymnosperm clade, making its photosynthetic machinery particularly informative about ancestral states.

  • Genome compactness: The Welwitschia plastome is exceptionally compact (119,726 bp) with 66% coding sequence, suggesting selection for efficiency in this long-lived desert species.

  • Gene loss and rearrangement: The Welwitschia chloroplast genome exhibits a minimum of 9 inversions that modify gene order and 19 genes that are lost or present as pseudogenes, indicating substantial evolutionary plasticity.

  • Adaptation signatures: The retention of functional Ycf4 despite significant genomic rearrangements suggests its critical importance for photosynthesis under extreme environmental conditions.

  • Lineage-specific whole genome duplication: The Welwitschia genome has been shaped by a lineage-specific ancient whole genome duplication (~86 million years ago), which may have influenced the evolution of its photosynthetic machinery .

These characteristics collectively suggest that photosynthetic apparatus evolution in gymnosperms involves both conservation of essential components like Ycf4 and adaptation to specific ecological niches.

What are common challenges in expressing and maintaining stability of recombinant Welwitschia mirabilis Ycf4, and how can they be addressed?

Researchers frequently encounter several challenges when working with recombinant Welwitschia Ycf4:

  • Membrane protein expression:

    • Challenge: Low expression yields due to protein hydrophobicity

    • Solution: Optimize codon usage for expression system; use specialized expression vectors with strong promoters; consider fusion partners that enhance solubility

  • Protein aggregation:

    • Challenge: Formation of inclusion bodies

    • Solution: Express at lower temperatures (16-20°C); use mild detergents (0.2% DDM) during extraction; include stabilizing agents like glycerol (50%) in buffers

  • Protein degradation:

    • Challenge: Rapid proteolysis during purification

    • Solution: Include protease inhibitor cocktails; maintain samples at 4°C; minimize freeze-thaw cycles

  • Complex disassembly:

    • Challenge: Dissociation of the large Ycf4 complex during purification

    • Solution: Use gentle purification methods; maintain appropriate salt and detergent concentrations; consider chemical crosslinking to stabilize complexes

  • Storage stability:

    • Challenge: Loss of activity during storage

    • Solution: Store in Tris-based buffer with 50% glycerol at -20°C; for extended storage, use -80°C; avoid repeated freeze-thaw cycles

How can researchers investigate the interaction between Ycf4 and COP2 in Welwitschia mirabilis, and what controls should be implemented?

To investigate the Ycf4-COP2 interaction in Welwitschia mirabilis:

How might knowledge of Welwitschia mirabilis Ycf4 contribute to understanding plant adaptation to extreme environments?

The study of Welwitschia mirabilis Ycf4 offers significant insights into plant adaptation to harsh environments:

  • Stress-resistant photosynthesis: Understanding how PSI assembly and function are maintained under extreme desert conditions could reveal novel adaptation mechanisms, particularly as different populations show variable photosynthetic potential (PIABS values) across catchments .

  • Longevity mechanisms: Given Welwitschia's exceptional lifespan (up to 3,000 years), investigating how its photosynthetic machinery, including Ycf4-mediated PSI assembly, maintains functionality over centuries could inform longevity research.

  • Water efficiency strategies: Research into PSI structure and function in this desert-adapted species may reveal unique modifications that enhance photosynthetic water-use efficiency.

  • Genomic adaptation signatures: The high levels of cytosine methylation (particularly at CHH motifs) associated with retrotransposons and the exceptionally GC-poor genome resulting from long-term deamination likely impact gene regulation including photosynthetic genes like Ycf4 .

  • Evolutionary resilience: As a "living fossil" with 112 My fossil records, Welwitschia's photosynthetic apparatus represents an evolutionary success story, potentially harboring unique innovations that contributed to its survival through major climate shifts.

What are the implications of the recently discovered DNA viruses in Welwitschia mirabilis for research on Ycf4 and photosynthetic function?

The recent identification of four novel DNA viruses in Welwitschia mirabilis raises important considerations for Ycf4 research:

  • Virus-host interactions: The discovery of Welwitschia mirabilis virus 1 and 2 (WMV1-WMV2) and Welwitschia mirabilis associated geminivirus A and B (WMaGVA-WMaGVB) suggests potential viral interactions with host photosynthetic machinery, including possible impacts on Ycf4 function .

  • Evolutionary co-adaptation: The detection of endogenous virus-like elements (EVEs) related to these viruses in the Welwitschia genome suggests a shared ancient evolutionary history, potentially influencing the evolution of photosynthetic genes .

  • Methodological considerations: Researchers investigating Ycf4 function should consider viral status of their plant material, as infection could potentially confound experimental results.

  • Comparative studies: Comparing Ycf4 function between virus-free and virus-infected plants could reveal novel aspects of photosynthetic regulation under biotic stress.

  • Conservation implications: Understanding how these unique viruses interact with the photosynthetic apparatus could inform conservation strategies for this ancient species, particularly as mining activities expand in its native range .

How can chlorophyll fluorescence data be effectively integrated with Ycf4 expression studies to monitor Welwitschia mirabilis health?

Integration of chlorophyll fluorescence data with Ycf4 expression studies provides a powerful approach to monitoring Welwitschia health:

  • JIP-test parameter correlation: Correlate specific JIP-test parameters (φPO, ψEo, γRC) with Ycf4 expression levels to establish baseline relationships.

  • Composite health indices: Develop comprehensive health indices combining PIABS values (photosynthetic performance index) with Ycf4 protein abundance measurements.

  • Temporal monitoring protocol:

    • Measure chlorophyll fluorescence parameters seasonally

    • Collect small tissue samples for concurrent Ycf4 expression analysis

    • Track correlations between environmental factors, fluorescence parameters, and Ycf4 expression

  • Catchment-specific baselines: Establish baseline values for different catchment populations, as significant differences in photosynthetic potential (PIABS values) have been observed between plants in different localities (e.g., Campsite vs. River Channel) .

  • Environmental impact assessment: Apply this integrated approach to assess potential impacts of mining operations or climate change on Welwitschia health, using the relationship between Ycf4 expression and photosynthetic efficiency as a sensitive bioindicator.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.