Recombinant Welwitschia mirabilis Photosystem II CP47 chlorophyll apoprotein (psbB)

Shipped with Ice Packs
In Stock

Description

Functional Role in Photosystem II

CP47 (psbB) is indispensable for PSII’s structural integrity and photochemical activity. Key functions include:

  • Chlorophyll Binding: Anchors multiple chlorophyll molecules, enhancing light absorption and energy transfer to the reaction center .

  • Reaction Center Stabilization: Forms a scaffold for the D1/D2 heterodimer and cytochrome b559, ensuring proper electron transport .

  • Oxygen Evolution: Interacts with the extrinsic oxygen-evolving complex (OEC) proteins to facilitate water splitting .

In Welwitschia, rapid sequence divergence in plastid-encoded genes like psbB has been observed, suggesting adaptive evolution under extreme desert conditions .

Synthesis and Purification

The recombinant protein is produced via bacterial expression systems:

HostAdvantagesChallenges
E. coliHigh yield, rapid turnaround, cost-effectiveLimited post-translational modifications
Insect CellsProper disulfide bonding, membrane integrationLower yield, complex workflows
Mammalian CellsNative-like folding, activity retentionHigh cost, long production cycles

The E. coli-derived version (Cat. No. RFL25969WF) undergoes affinity chromatography and lyophilization, with a recommended reconstitution concentration of 0.1–1.0 mg/mL . Avoidance of freeze-thaw cycles is critical to preserve tertiary structure .

Functional Assays

  • Oxygen Evolution: Quantification of H2O splitting activity in reconstituted PSII complexes.

  • Photoprotection: Studies on thermal stability and photodamage resistance under stress .

Biotechnological Potential

  • Artificial Photosynthesis: Engineering CP47 variants for improved light-harvesting in biohybrid systems.

  • Stress Tolerance: Leveraging Welwitschia’s extreme adaptations (e.g., drought resistance) to enhance crop resilience .

Genomic and Evolutionary Context

The Welwitschia plastid genome (119,726 bp) is among the smallest in non-parasitic land plants, with psbB encoded in the large single-copy region . Key genomic features include:

  • Rapid Divergence: psbB sequences evolve 2–3× faster than other seed plants, reflecting adaptive pressures .

  • Gene Loss: 19 plastid genes are lost or pseudogenized, including some linked to photosynthesis .

Critical Challenges

  • Structural Instability: Requires careful handling to prevent aggregation or denaturation.

  • Host Limitations: E. coli-produced CP47 lacks post-translational modifications critical for native activity .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate specific format requests. Please indicate your preferred format in the order notes, and we will do our best to fulfill your requirements.
Lead Time
Delivery times may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timelines.
Note: All protein shipments are standardly accompanied by normal blue ice packs. If dry ice shipment is required, please inform us in advance as additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. For optimal preservation, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, serving as a reference point for customers.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life for liquid form is 6 months at -20°C/-80°C. Lyophilized form exhibits a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
Tag type is determined during production. If you have a specific tag preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
psbB; Photosystem II CP47 reaction center protein; PSII 47 kDa protein; Protein CP-47
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-508
Protein Length
full length protein
Species
Welwitschia mirabilis (Tree tumbo) (Welwitschia bainesii)
Target Names
psbB
Target Protein Sequence
MGLPWYRVHTVVLNDPGRLIAVHIMHTALVAGWAGSMALYELAVFDPSDSVLDPMWRQGM FILPFMTRLGIKESWGGWSITGEPIANPGLWSYEGVAGAHIVFSGLCFLSATWHWVYWDL EIFSDPRTGKPSLDLPKIFGIHLFLSGVACFGFGAFHVTGLYGPGIWVSDPFGLTGKIQP VSPAWGAEGFDPFVPGGIASHHVAAGLLGIIAGLFHLSVRPPQRLYRGLRMGNIETVLSS SIAAVFFAAFIVAGTMWYGSATTPIELFGPTRYQWDQGYFQQEIDRRVQAGLAENLSLSE AWSRIPEKLAFYDYIGNNPAKGGLFRAGAMDNGDGIAVGWLGHPIFKDKEGNELFVRRMP TFFETFPVVLVDKEGVIKADIPFRRAESKYSVEQVGVTVEFYGGELNGVSFSDPAIVKKY ARRAQLGEIFELDRATLKSDGVFRSSPRGWFTFGHATFALLFFFGHIWHGARTLFRDIFA GIDPELDIQVEFGAFQKIGDPTTKRQVV
Uniprot No.

Target Background

Function
Recombinant Welwitschia mirabilis Photosystem II CP47 chlorophyll apoprotein (psbB) is a vital component of the core complex within photosystem II (PSII). This protein binds chlorophyll and plays a crucial role in catalyzing the primary light-induced photochemical reactions of PSII. PSII functions as a light-driven water:plastoquinone oxidoreductase, harnessing light energy to extract electrons from H₂O, generating O₂ and a proton gradient subsequently utilized for ATP formation.
Protein Families
PsbB/PsbC family, PsbB subfamily
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is Welwitschia mirabilis and why is it significant for photosystem research?

Welwitschia mirabilis is an extraordinary gymnosperm endemic to the Namib Desert and the sole living species within the family Welwitschiaceae. Its significance stems from its remarkable longevity (up to 2,000 years) and unique morphological characteristics, including a single pair of continuously growing leaves that persist throughout its lifetime . The plant has evolved exceptional adaptations to survive in one of the world's harshest environments, making its photosynthetic machinery, particularly the Photosystem II components, of significant interest to evolutionary biologists and photosynthesis researchers. The study of its Photosystem II CP47 chlorophyll apoprotein (psbB) can provide insights into how photosynthetic mechanisms adapt to extreme conditions over evolutionary time .

What is the structural composition of Welwitschia mirabilis psbB protein?

The Photosystem II CP47 chlorophyll apoprotein (psbB) from Welwitschia mirabilis is a full-length protein consisting of 508 amino acids. The protein functions as a core antenna protein in Photosystem II, binding chlorophyll molecules and facilitating energy transfer to the reaction center. The complete amino acid sequence is available and characterized by distinct hydrophobic regions that anchor the protein within the thylakoid membrane . The protein contains multiple transmembrane domains and chlorophyll-binding sites essential for its function in light harvesting and energy transfer within the photosynthetic apparatus.

How does the psbB gene fit into the broader genomic context of Welwitschia mirabilis?

The psbB gene is one of 39,019 protein-coding genes identified in the Welwitschia mirabilis genome, which has been sequenced and assembled at the chromosome level with a total size of 6.30 Gb and a contig N50 of 27.50 Mb . The gene encodes the CP47 protein, an essential component of Photosystem II. Within the evolutionary context, it represents one of the conserved photosynthetic genes that have been maintained throughout gymnosperm evolution, despite the extreme environmental adaptations exhibited by Welwitschia. The genomic context is particularly interesting given that Welwitschia diverged from other gnetophytes like Gnetum montanum approximately 123.5 million years ago .

What are the potential applications of the recombinant Welwitschia mirabilis psbB protein in photosynthesis research?

The availability of recombinant Welwitschia mirabilis psbB protein enables several advanced research applications:

  • Structural studies: The protein can be used for crystallography or cryo-electron microscopy to determine high-resolution structures of CP47 from this evolutionarily distinct plant.

  • Functional reconstitution experiments: Researchers can perform in vitro reconstitution of Photosystem II components to study energy transfer dynamics specific to Welwitschia.

  • Comparative analysis: The recombinant protein allows direct comparison with CP47 from other species to identify unique adaptations.

  • Protein engineering: Understanding the stability mechanisms of this desert-adapted protein could inform the design of more robust photosynthetic systems for biotechnology applications.

  • Evolutionary studies: The protein serves as a valuable tool for investigating the molecular evolution of photosynthetic machinery in gymnosperms.

What expression system modifications are required for optimal production of functional Welwitschia mirabilis psbB?

Producing functional recombinant Welwitschia mirabilis psbB protein presents several challenges due to its hydrophobic nature and complex folding requirements. Based on successful expression protocols, the following methodological approach is recommended:

Expression ParameterOptimization StrategyRationale
Host systemE. coli BL21(DE3) for structural studies; insect cells for functional studiesBalance between yield and proper folding/modification
Induction temperature18°CReduces inclusion body formation
Induction time16-20 hoursAllows slower, more complete protein synthesis
Detergentn-Dodecyl β-D-maltoside (DDM)Effectively solubilizes membrane proteins while maintaining structure
Tag positionN-terminal His-tagMinimizes interference with protein folding

What purification protocol yields the highest activity for recombinant Welwitschia mirabilis psbB protein?

Obtaining high-activity recombinant Welwitschia mirabilis psbB protein requires a carefully optimized purification protocol that preserves structural integrity. Based on established methods for similar photosynthetic proteins, the following stepwise approach is recommended:

  • Cell lysis and membrane fraction isolation:

    • Resuspend E. coli cells in buffer containing 50 mM Tris-HCl (pH 8.0), 200 mM NaCl, and protease inhibitors

    • Disrupt cells using sonication or French press

    • Separate membrane fraction by ultracentrifugation (100,000 × g, 1 hour)

  • Membrane protein solubilization:

    • Solubilize membrane fraction in buffer containing 1% n-Dodecyl β-D-maltoside (DDM)

    • Incubate with gentle rotation at 4°C for 1 hour

    • Remove insoluble material by centrifugation (20,000 × g, 30 minutes)

  • Affinity chromatography:

    • Apply solubilized protein to Ni-NTA resin equilibrated with buffer containing 50 mM Tris-HCl (pH 8.0), 200 mM NaCl, 0.05% DDM

    • Wash extensively to remove non-specifically bound proteins

    • Elute protein using an imidazole gradient (50-300 mM)

  • Size exclusion chromatography:

    • Further purify protein by size exclusion chromatography to remove aggregates and ensure homogeneity

    • Use buffer containing 20 mM Tris-HCl (pH 8.0), 100 mM NaCl, 0.03% DDM

  • Quality control:

    • Verify purity by SDS-PAGE (>90% purity should be achieved)

    • Confirm protein identity by Western blot and/or mass spectrometry

    • Assess functional integrity through chlorophyll binding assays

How should researchers properly store and reconstitute the lyophilized Welwitschia mirabilis psbB protein?

Proper storage and reconstitution are critical for maintaining protein activity. Based on established protocols for photosystem proteins:

  • Storage conditions:

    • Store lyophilized protein at -20°C or -80°C

    • Avoid repeated freeze-thaw cycles, which can denature the protein

    • For working aliquots, store at 4°C for up to one week

  • Reconstitution protocol:

    • Briefly centrifuge the vial before opening to collect all material at the bottom

    • Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

    • For long-term storage of reconstituted protein, add glycerol to a final concentration of 5-50% (50% is recommended)

    • Prepare small aliquots to minimize freeze-thaw cycles

  • Activity verification:

    • After reconstitution, verify protein activity through spectroscopic analysis of chlorophyll binding

    • Assess secondary structure integrity via circular dichroism spectroscopy

    • For functional studies, consider reconstitution with thylakoid lipids to form proteoliposomes

What are the optimal conditions for studying chlorophyll binding to recombinant Welwitschia mirabilis psbB protein?

Studying chlorophyll binding to recombinant psbB protein requires careful experimental design:

  • Buffer composition:

    • Use 20 mM Tris-HCl (pH 7.5), 100 mM NaCl, 5 mM MgCl₂, 0.03% DDM

    • Include 5% glycerol to enhance protein stability

    • Ensure oxygen-free conditions by degassing buffers and using an oxygen scavenger system

  • Chlorophyll preparation:

    • Extract chlorophyll a and b from spinach or other readily available plant material using acetone extraction

    • Purify using HPLC to obtain individual pigment species

    • Prepare stock solutions in ethanol or acetone (concentration: 1 mM)

  • Reconstitution methodology:

    • Mix purified psbB protein (2 μM) with chlorophyll (8-10 μM) in reconstitution buffer

    • Dilute organic solvent to <1% final concentration to avoid protein denaturation

    • Incubate at 4°C in the dark with gentle agitation for 12-24 hours

    • Remove unbound pigments by gel filtration or sucrose gradient centrifugation

  • Analysis techniques:

    • UV-Vis spectroscopy (350-750 nm) to confirm chlorophyll binding

    • Fluorescence spectroscopy to assess energy transfer within the protein-pigment complex

    • Circular dichroism to evaluate protein secondary structure integrity

  • Controls:

    • Denatured protein (heat-treated) to assess non-specific binding

    • Other chlorophyll-binding proteins (e.g., LHCII) as positive controls

    • Buffer-only samples to establish baseline measurements

How can researchers effectively assess the functional integrity of recombinant Welwitschia mirabilis psbB in reconstituted Photosystem II complexes?

Assessing functional integrity of psbB in reconstituted PSII complexes requires multiple analytical approaches:

  • Oxygen evolution measurements:

    • Use a Clark-type oxygen electrode to measure oxygen evolution in reconstituted PSII complexes

    • Standard reaction mixture: 50 mM MES (pH 6.5), 20 mM NaCl, 5 mM MgCl₂, 1 mM K₃Fe(CN)₆, and 0.5 mM 2,6-dichlorobenzoquinone as electron acceptors

    • Compare activity with native PSII preparations from model organisms

  • Chlorophyll fluorescence analysis:

    • Measure variable fluorescence (Fv/Fm) to assess maximum quantum efficiency

    • Perform fluorescence induction kinetics to evaluate electron transport

    • Use pulse-amplitude modulation (PAM) fluorometry for detailed photochemical analysis

  • Spectroscopic assessment:

    • Perform low-temperature (77K) fluorescence emission spectroscopy to evaluate energy coupling

    • Use transient absorption spectroscopy to examine electron transfer kinetics

    • Employ circular dichroism to confirm proper protein folding and pigment organization

  • Biochemical validation:

    • Perform blue native gel electrophoresis to confirm protein complex assembly

    • Use immunoblotting with antibodies against key PSII subunits to verify interactions

    • Assess binding of specific inhibitors (e.g., DCMU) to confirm binding site integrity

Analytical MethodParameter MeasuredExpected Values for Functional Protein
Oxygen evolutionO₂ production rate150-400 μmol O₂/mg Chl/h
Chlorophyll fluorescenceFv/Fm ratio0.75-0.85
77K fluorescenceEmission maximaPeaks at 685 nm and 695 nm
Blue native PAGEComplex assemblyDistinct band at ~450 kDa

How should researchers interpret differences in spectroscopic properties between native and recombinant Welwitschia mirabilis psbB?

When comparing spectroscopic properties of native and recombinant psbB proteins, researchers should consider:

  • Absorption spectra analysis:

    • Compare peak positions and relative intensities in the Soret (~400-500 nm) and Qy (~650-700 nm) regions

    • Shifts in peak positions may indicate altered pigment-protein interactions

    • Broadening of peaks often suggests heterogeneity in pigment binding sites

  • Circular dichroism interpretation:

    • Evaluate far-UV spectra (190-250 nm) to compare secondary structure content

    • Assess visible region (350-700 nm) to examine pigment-protein interactions

    • Quantify differences using spectral deconvolution software

  • Fluorescence data analysis:

    • Compare emission maxima positions and bandwidths

    • Analyze fluorescence lifetime distributions to identify population heterogeneity

    • Assess energy transfer efficiency through excitation spectra

  • Statistical approaches:

    • Perform multiple measurements (n ≥ 3) to establish statistical significance

    • Use appropriate statistical tests (t-test, ANOVA) to validate differences

    • Calculate effect sizes to quantify the magnitude of observed differences

  • Common interpretation pitfalls:

    • Avoid overinterpreting minor spectral differences (<2 nm shifts or <5% intensity changes)

    • Consider the impact of different detergent environments on spectral properties

    • Account for potential artifacts from His-tag or other modifications in recombinant proteins

What are the current challenges in resolving the 3D structure of Welwitschia mirabilis psbB and how can they be addressed?

Resolving the 3D structure of Welwitschia mirabilis psbB presents several challenges that require methodological solutions:

  • Protein stability challenges:

    • The hydrophobic nature of psbB makes it prone to aggregation

    • Solution: Screen multiple detergents and lipid nanodisc systems to identify optimal stabilizing conditions

    • Consider fusion with crystallization chaperones to enhance stability

  • Crystallization barriers:

    • Membrane proteins are notoriously difficult to crystallize

    • Solution: Implement lipidic cubic phase crystallization techniques

    • Employ surface entropy reduction through targeted mutations of flexible loops

  • Cryo-EM considerations:

    • The relatively small size of isolated psbB (~56 kDa) makes it challenging for cryo-EM

    • Solution: Study psbB in the context of larger PSII complexes

    • Use Volta phase plates and energy filters to enhance contrast

  • Comparative modeling limitations:

    • While templates exist from other species, unique adaptations in Welwitschia may not be captured

    • Solution: Combine homology modeling with experimental constraints from crosslinking and mass spectrometry

    • Validate models using small-angle X-ray scattering (SAXS) data

  • Proposed integrated approach:

    • Begin with AlphaFold or RoseTTAFold predictions as starting models

    • Refine using experimental constraints from hydrogen-deuterium exchange mass spectrometry

    • Validate through site-directed mutagenesis of predicted functional residues

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.