Recombinant Western equine encephalitis virus Structural polyprotein, partial

Shipped with Ice Packs
In Stock

Description

The Western Equine Encephalitis Virus: Origin and Structure

Western equine encephalitis virus was first identified during a 1930 outbreak in California's San Joaquin Valley that caused approximately 6,000 cases of encephalitis in horses . WEEV belongs to the Alphavirus genus within the Togaviridae family and has a unique evolutionary history as a recombinant virus. Genomic analyses reveal that WEEV descended from a recombinant ancestor that acquired its nonstructural and capsid protein genes from an Eastern Equine Encephalitis Virus (EEEV) strain, while its envelope glycoprotein genes originated from an ancestral Sindbis virus .

The WEEV genome encodes four nonstructural proteins (nsP1–nsP4) and six structural proteins (capsid, E3, E2, 6K, TF, and E1) . These structural proteins are initially synthesized as part of a large polyprotein precursor that undergoes post-translational processing to yield the individual proteins . Each component of this structural polyprotein serves crucial functions in viral architecture and infection: the capsid forms the nucleocapsid core, while the envelope glycoproteins E1 and E2 form heterodimers that constitute the virus's external spikes and mediate host cell attachment and membrane fusion .

Expression Systems

Various expression systems have been employed to produce partial recombinant forms of the WEEV structural polyprotein, each with distinct advantages and limitations.

Baculovirus Expression System

The baculovirus-insect cell expression system has been extensively used to produce recombinant WEEV glycoproteins. This system allows for eukaryotic post-translational modifications, particularly glycosylation, which is crucial for proper folding and function of viral envelope proteins . Researchers have created twelve different recombinant baculoviruses designed to express four different WEEV glycoprotein constructs under the transcriptional control of three temporally distinct baculovirus promoters .

The four WEEV glycoprotein constructs included:

  1. Full-length E1

  2. E1 ectodomain (E1ecto)

  3. E26KE1 polyprotein precursor

  4. An artificial, secretable E2E1 chimera (E2E1chim)

Expression of these constructs was controlled by promoters that induced gene expression during different phases of baculovirus infection:

  • Immediate early phase (ie1)

  • Late phase (p6.9)

  • Very late phase (polh)

Bacterial Expression Systems

Escherichia coli has been successfully used to express the E2 glycoprotein component of the WEEV structural polyprotein. In this system, the E2 protein typically accumulates as inclusion bodies that require solubilization and refolding to obtain functional protein . Despite lacking glycosylation, E. coli-expressed recombinant E2 (rE2) protein retains some functional characteristics of its native conformation and can be recognized by antibodies from WEEV-immunized specimens .

Commercial sources now offer recombinant WEEV structural polyprotein fragments expressed in E. coli with N-terminal histidine tags. These products typically have a predicted molecular weight of approximately 43.7 kDa, representing partial segments of the full structural polyprotein .

Factors Affecting Production Efficiency

Research has identified several factors that influence the quantity and quality of recombinant WEEV glycoprotein products obtained from expression systems.

Construct Design

The specific design of the WEEV glycoprotein construct significantly impacts the solubility and yield of recombinant products. When expressed in the baculovirus system, full-length E1 consistently produces insoluble protein regardless of the timing of expression . In contrast, partial constructs such as the E1 ectodomain, E26KE1 polyprotein, and E2E1 chimera yield soluble products under appropriate conditions .

The E2E1 chimera construct represents an innovative approach for producing partial recombinant WEEV structural proteins. This construct consists of E2 and E1 ectodomains connected by a flexible peptide linker [(Gly-Gly-Gly-Gly-Ser)3], eliminating the need for proteolytic processing .

Timing of Expression

The timing of recombinant protein expression profoundly affects the processing efficiency of WEEV glycoproteins. Studies comparing immediate early (ie1), late (p6.9), and very late (polh) promoters revealed that:

Table 1: Comparison of WEEV Glycoprotein Expression Under Different Promoters

Constructie1 Promoterp6.9 Promoterpolh Promoter
Full-length E1No detectable productInsoluble productInsoluble product
E1 ectodomainHigher processing efficiencyModerate processing, higher yieldLower processing, similar yield
E26KE1No detectable product~85% processing efficiency~50% processing efficiency
E2E1 chimeraModerate expressionGood expression with efficient processingGood expression with less efficient processing

Cryo-Electron Microscopy Studies

Cryo-electron microscopy (cryo-EM) has been instrumental in characterizing the structure of WEEV particles and their component proteins. The first three-dimensional structure of WEEV was determined at 13-Å resolution using a specialized BSL-3 cryo-EM containment facility . This study revealed that the E1 and E2 proteins form heterodimers that oligomerize into trimeric spikes projecting from the viral surface .

More recent high-resolution structural studies have provided detailed insights into the architecture of WEEV proteins. The structure of WEEV CBA87 virus-like particles (VLPs) has been determined, offering valuable information about the organization of the structural proteins in a non-infectious form . These VLPs contained the full complement of structural proteins including capsid, E3, E2, and E1, allowing detailed examination of their interactions and conformations .

Receptor Binding Properties

Recent research has identified protocadherin 10 (PCDH10) as a cellular receptor for WEEV . Additionally, some highly virulent ancestral WEEV strains isolated in the 1930s and 1940s could also bind very low-density lipoprotein receptor (VLDLR) and apolipoprotein E receptor 2 (ApoER2) .

The receptor binding capabilities of WEEV appear to have evolved over time. While most WEEV strains examined bind to PCDH10, contemporary strains have lost the ability to recognize mammalian PCDH10 while retaining binding to avian receptors, suggesting adaptation to avian reservoir hosts during enzootic circulation .

High-resolution structural studies of receptor-bound WEEV spikes have revealed the molecular basis for these interactions. The VLDLR low-density lipoprotein (LDL) binding domain forms contacts with the E2'-E1' protomer of the WEEV spike, primarily through LA1 and LA2 repeats . Similarly, the EC1 domain of PCDH10 interacts with specific regions of the WEEV glycoproteins .

Antigenic Properties

The E2 glycoprotein of WEEV is a major antigenic determinant that elicits neutralizing antibodies following infection . Studies with recombinant E2 protein have demonstrated that even non-glycosylated forms produced in E. coli can retain antigenic properties and induce both humoral and cell-mediated immune responses in experimental animals .

Immunization with recombinant E2 protein provides partial protection against lethal WEEV challenge in mouse models, indicating its potential utility for vaccine development . The immunogenic properties of recombinant WEEV structural proteins make them valuable tools for developing diagnostic assays, vaccines, and therapeutics.

Vaccine Development

Recombinant WEEV structural polyprotein components have significant potential for vaccine development. The E1 and E2 glycoproteins are particularly promising candidates as they include epitopes that elicit neutralizing antibodies .

Different approaches to vaccine development have been explored:

  1. Subunit vaccines using purified recombinant E1 or E2 proteins

  2. Virus-like particles containing multiple structural proteins

  3. DNA vaccines encoding WEEV structural proteins

  4. Vectored vaccines expressing WEEV antigens

Previous studies have shown that E1 glycoprotein can provide 100% protection in mouse models and potentially cross-protection against multiple alphaviruses . The E2E1 heterodimer complex may induce a more effective immune response than E1 alone .

Therapeutic Applications

Beyond vaccines, recombinant WEEV structural proteins have applications in developing therapeutic interventions. Receptor decoy proteins comprising the EC1 domain of PCDH10 or the VLDLR LBD can block WEEV infection by preventing viral binding to cellular receptors .

Understanding the structural determinants of WEEV-receptor interactions has facilitated the development of these novel therapeutic approaches. Polymorphisms in the WEEV spike protein that determine receptor dependencies can potentially be targeted to prevent infection or mitigate disease severity .

Diagnostic Applications

Recombinant WEEV structural proteins are valuable reagents for developing serological assays to detect anti-WEEV antibodies in infected hosts. The availability of well-characterized recombinant proteins allows for the development of standardized ELISA and other immunoassays with improved specificity compared to traditional methods using inactivated whole viruses .

Production Challenges

Despite advances in recombinant protein technology, producing soluble, correctly folded WEEV structural proteins remains challenging. The complex nature of these viral glycoproteins, with multiple disulfide bonds and glycosylation sites, complicates their expression in heterologous systems .

Future efforts may focus on:

  1. Optimizing expression conditions to improve folding and solubility

  2. Developing novel constructs that better mimic the native conformation of WEEV glycoproteins

  3. Exploring alternative expression systems that provide appropriate post-translational modifications

Emerging Applications

Recent structural insights into WEEV-receptor interactions open new possibilities for therapeutic development. The identification of receptor binding domains and their structural characterization provides targets for designing small molecule inhibitors or antibodies that block viral entry .

The observed shift in receptor specificity among contemporary WEEV strains raises important questions about viral evolution and adaptation. Understanding these changes may help predict the potential for re-emergence of highly virulent strains and guide the development of broadly protective vaccines and therapeutics .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify any format requirements in your order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms maintain stability for 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
Structural polyprotein; p130
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
798-1236
Protein Length
Partial
Species
Western equine encephalitis virus (WEEV)
Target Protein Sequence
FEHATTVPNVPGIPYKALVERAGYAPLNLEITVVSSELTPSTNKEYVTCRFHTVIPSPQV KCCGSLECKASSKADYTCRVFGGVYPFMWGGAQCFCDSENTQLSEAYVEFAPDCTIDHAV ALKVHTAALKVGLRIVYGNTTAHLDTFVNGVTPGSSRDLKVIAGPISAAFSPFDHKVVIR KGLVYNYDFPEYGAMKPGAFGDIQASSLDATDIVARTDIRLLKPSVKNIHVPYTQAVSGY EMWKNNSGRPLQETAPFGCKIEVEPLRASNCAYGHIPISIDIPDAAFVRSSESPTILEVS CTVADCIYSADFGGSLTLQYKADREGHCPVHSHSTTAVLKEATTHVTAVGSITLHFSTSS PQANFIVSLCGKKTTCNAECKPPADHIIGEPHKVDQEFQAAVSKTSWNWLLALFGGASSL IVVGLIVLVCSSMLINTRR
Uniprot No.

Target Background

Function

This protein forms an icosahedral capsid with T=4 symmetry, comprising 240 copies of the capsid protein enveloped by a lipid membrane. Eighty spikes, each composed of E1-E2 heterodimer trimers, penetrate this membrane. The capsid protein binds to the viral RNA genome near a ribosome binding site, facilitating genome translation post-release. It possesses protease activity, autocatalytically cleaving from the nascent structural protein. Following self-cleavage, it transiently associates with ribosomes before binding viral RNA and assembling into icosahedral core particles. This nucleocapsid then interacts with the cytoplasmic domain of the spike glycoprotein E2 at the cell membrane, leading to budding and mature virion formation.

During infection, virions attach to target cells and undergo clathrin-mediated endocytosis. The viral membrane fuses with the host endosomal membrane, releasing the nucleocapsid into the cytoplasm. Subsequent uncoating, possibly triggered by capsid protein-ribosome interaction, makes the genomic RNA accessible. The protein specifically inhibits interleukin-1 receptor-associated kinase 1 (IRAK1)-dependent signaling during viral entry, potentially evading innate immune detection. It also inhibits host transcription by forming a tetrameric complex with XPO1/CRM1 and importin, blocking the nuclear pore's central channel and impeding receptor-mediated nuclear transport of host mRNA and rRNA.

The E3 protein provides the signal sequence for E3/E2 precursor translocation to the host endoplasmic reticulum. Furin-cleaved E3 remains associated with E1, protecting it at low pH during secretory pathway transport. Post-release, E3 is gradually released extracellularly. E2 plays a crucial role in viral attachment by binding to the cell receptor. Synthesized as a pE2 precursor, it's processed by furin at the cell membrane before budding, forming the E2-E1 heterodimer. pE2 processing occurs late to prevent premature E1 fusion activation. E2's C-terminus contains a transient transmembrane domain disrupted by palmitoylation, reorienting the C-terminal tail to the cytoplasm. This is crucial for budding via capsid protein interaction.

Protein 6K acts as a viroporin involved in glycoprotein processing, cell permeabilization, and viral budding. It disrupts calcium homeostasis, likely at the endoplasmic reticulum, increasing cytoplasmic calcium levels. Its lipophilic nature suggests influence on lipid selection interacting with glycoprotein transmembrane domains, affecting bilayer deformability needed for budding. It's present in low virion amounts (approximately 3% compared to glycoproteins).

E1 is a class II viral fusion protein. Its fusion activity is inactive while bound to E2 in mature virions. Endosomal acidification post-attachment induces E1/E2 dissociation and E1 trimerization, activating fusion and releasing the nucleocapsid into the cytoplasm. Efficient fusion requires target membrane cholesterol and sphingolipids.

Subcellular Location
[Capsid protein]: Virion. Host cytoplasm. Host cell membrane. Host nucleus.; [Spike glycoprotein E2]: Virion membrane; Single-pass type I membrane protein. Host cell membrane; Single-pass type I membrane protein.; [6K protein]: Host cell membrane; Multi-pass membrane protein. Virion membrane; Multi-pass membrane protein.; [Spike glycoprotein E1]: Virion membrane; Single-pass type I membrane protein. Host cell membrane; Single-pass type I membrane protein.

Q&A

What is the composition of the Western equine encephalitis virus structural polyprotein?

The WEEV structural polyprotein is a large precursor protein that undergoes proteolytic processing to yield multiple functional viral proteins. The polyprotein precursor consists of capsid, E3, E2, 6K, and E1 proteins arranged in that order . During viral replication, this polyprotein is cleaved into individual components, with the capsid protein forming the nucleocapsid core that packages the viral RNA genome. The E1 and E2 glycoproteins form heterodimers that protrude from the viral envelope as 80 trimeric spikes, which are crucial for receptor binding and membrane fusion . The E3 protein functions as a chaperone for proper E2 folding, while the small hydrophobic 6K protein plays roles in membrane permeability and virus budding.

What evolutionary events led to the formation of WEEV?

WEEV represents a natural example of viral recombination driving evolution and emergence of new pathogens. Comparative sequence analysis has conclusively demonstrated that WEEV arose through recombination between an Eastern equine encephalitis virus (EEEV)-like virus and a Sindbis-like virus . The capsid protein and 3'-terminal untranslated region (approximately 80 nucleotides) of WEEV are closely related to EEEV sequences, whereas the E2 and E1 glycoproteins share greater homology with Sindbis virus . This recombination event created a chimeric virus possessing the encephalogenic properties of EEEV combined with the antigenic characteristics of Sindbis virus. The successful emergence of WEEV provides compelling evidence for the importance of recombination in RNA virus evolution and diversification .

How does the structural organization of WEEV compare to other alphaviruses?

CryoEM studies have revealed that WEEV particles are approximately 700 Å in diameter and exhibit T=4 quasi-symmetry within their icosahedral lattice . The virion consists of three major structural layers: an outer glycoprotein shell formed by E1/E2 heterodimers, a lipid bilayer derived from the host cell positioned approximately 230 Å from the particle center, and an inner nucleocapsid core with pronounced capsomers .

Structural proteinVirus% Amino acid identity with:
AURAVVEEVSINVSFV
CapsidWEEV46655150
E2 envelope glycoproteinWEEV46406836
E1 envelope glycoproteinWEEV59497648

Table 1: Amino acid identity percentages between WEEV structural proteins and corresponding proteins from other alphaviruses. Data from Sherman & Weaver, 2010 .

Which expression systems are most effective for producing recombinant WEEV structural proteins?

Multiple expression systems have been employed for recombinant WEEV protein production, each with distinct advantages:

  • Baculovirus Expression Vector System (BEVS): This has been extensively utilized due to its capacity to provide high yields, eukaryotic glycosylation patterns, and relative biosafety . Studies have evaluated expression under three temporally distinct baculovirus promoters: immediate early (ie1), late (p6.9), and very late (polh).

  • Mammalian Cell Expression: HEK293T cells have successfully expressed recombinant WEEV proteins with >80% purity, suitable for applications requiring mammalian post-translational modifications .

  • Cytomegalovirus Promoter Systems: The structural polyprotein encoding region of WEEV strain 71V-1658 has been placed under CMV promoter control and transfected into tissue culture cells, yielding functional expression of viral envelope proteins as confirmed by immunostaining .

For therapeutic vaccine development and structural studies, BEVS remains particularly valuable due to its scalability and ability to produce proteins with conformations similar to native viral proteins .

How does the timing of gene expression affect the quality and yield of recombinant WEEV glycoproteins?

Research has established that the timing of gene expression critically influences both processing efficiency and final yield of recombinant WEEV glycoproteins . A comprehensive analysis comparing expression under ie1 (immediate early), p6.9 (late), and polh (very late) promoters revealed:

These findings demonstrate that both expression timing and construct design must be optimized simultaneously to maximize yield of properly folded, functional recombinant WEEV proteins.

How are WEEV structural polyproteins processed after expression?

The processing of WEEV structural polyproteins involves multiple proteolytic cleavage events and post-translational modifications that must occur in a coordinated sequence:

  • Autocatalytic Capsid Cleavage: The capsid protein possesses protease activity that results in its autocatalytic cleavage from the nascent structural polyprotein . Following self-cleavage, the capsid protein transiently associates with ribosomes before binding viral RNA and assembling into icosahedral core particles.

  • Signal Peptidase Cleavages: Host signal peptidases in the endoplasmic reticulum membrane cleave between E3-E2, E2-6K, and 6K-E1, releasing the individual glycoproteins .

  • E3-E2 Processing: The E3 protein initially remains associated with E2 as a precursor (p62 or PE2) that assists in proper folding of E2. Later, cellular furin-like proteases cleave between E3 and E2 during transit through the Golgi apparatus.

When expressing recombinant WEEV polyprotein in the baculovirus system, research has shown that processing efficiency varies significantly depending on the timing of expression. Expression during the late phase of infection (p6.9 promoter) yields approximately 85% processing of the polyprotein, while expression during the very late phase (polh promoter) results in only about 50% processing . This difference likely reflects the changing cellular environment and processing capacities during the progression of baculovirus infection.

What role does N-glycosylation play in WEEV glycoprotein structure and function?

N-glycosylation represents a critical post-translational modification that influences multiple aspects of WEEV glycoprotein biology:

  • Glycosylation Patterns: Western blotting analyses of recombinant full-length E1 expressed in insect cells have identified at least three major forms with different glycosylation states: unglycosylated, partially glycosylated (one N-glycan), and fully glycosylated (two N-glycans) . These patterns were confirmed through endoglycosidase treatments.

  • Incomplete Site Utilization: The presence of multiple glycoforms indicates that N-glycosylation site utilization and/or N-glycan processing was incomplete when full-length E1 was produced with baculovirus vectors .

  • Functional Implications: N-glycans contribute to proper protein folding, stability, and potentially immune evasion. The E2 proteins of both WEEV and Sindbis virus have potential N-linked glycosylation sites at residues 196 and 318, though glycan processing may differ between the viruses .

  • Expression System Considerations: When designing recombinant WEEV glycoprotein constructs, researchers must consider that different expression systems (insect vs. mammalian) produce different glycosylation patterns, which may impact protein folding, antigenicity, and functionality.

What specialized techniques have been developed to characterize the structure of WEEV?

Due to its classification as a biosafety level 3 (BSL-3) agent, specialized containment facilities and techniques have been developed for WEEV structural analysis:

  • BSL-3 CryoEM Facility: To safely image WEEV and other high-containment pathogens, researchers have constructed a first-of-its-kind BSL-3 cryoelectron microscopy containment facility . This specialized setup enables structural studies of highly infectious agents without compromising safety.

  • 3D Reconstruction Methods: Using cryoEM images collected under appropriate containment, researchers have determined the three-dimensional structure of WEEV to 13-Å resolution . For the related EEEV in complex with heparin, cryo-EM has achieved 5.8-Å resolution .

  • Difference Mapping: Comparative structural analysis between WEEV and other alphaviruses has employed difference mapping to highlight structural variations. This approach revealed that differences between WEEV and Sindbis virus occurred mainly within the E2 glycoprotein region of the spike, while E1 conformations showed greater similarity .

  • Homology Modeling: The positions and orientations of WEEV E1 proteins have been determined using homology models based on solved E1 structures from related alphaviruses like Semliki Forest virus .

These techniques have provided crucial insights into WEEV structure that inform understanding of its assembly, host interactions, and potential vulnerabilities for therapeutic targeting.

What strategies can optimize the solubility of recombinant WEEV structural proteins?

Research with WEEV structural proteins has identified several approaches to enhance protein solubility:

  • Construct Design: The nature of the construct dramatically influences solubility outcomes. While full-length E1 consistently yields insoluble products regardless of expression timing, three alternative constructs have produced soluble products :

    • E1 ectodomain (lacking the transmembrane domain)

    • E26KE1 polyprotein precursor

    • An engineered E2E1 chimera

  • Domain Fusion Strategies: A novel approach successfully employed for WEEV proteins involves creating an artificial E2E1 chimera consisting of the E2 and E1 ectodomains connected by a flexible peptide linker [(Gly-Gly-Gly-Gly-Ser)3] . This design eliminates the need for proteolytic processing while maintaining proper protein folding.

  • Expression Timing: For constructs that yield soluble products, expression during earlier phases of baculovirus infection generally provides higher processing efficiencies, though not necessarily higher final yields .

  • Secretion Signals: Incorporating appropriate signal sequences can direct recombinant proteins to the secretory pathway, potentially improving folding and solubility.

These strategies can be combined and optimized based on the specific research application and required protein characteristics.

How can researchers track viral entry and spread using recombinant WEEV?

Advanced recombinant WEEV systems have been developed to facilitate the study of viral entry, replication, and dissemination:

  • Reporter-Expressing Recombinant Viruses: Researchers have generated recombinant WEEV expressing reporter proteins such as firefly luciferase or dsRed (RFP) . These systems enable real-time tracking of viral infection in cell culture and animal models.

  • Passive Immunotherapy Control: To study viral spread without lethal outcomes, viral replication can be controlled using passive immunotherapy, allowing observation of neurological effects following non-lethal encephalitic infection .

  • Temporal Tracking: Using reporter-expressing WEEV, researchers have tracked viral spread from the olfactory bulb to the entorhinal cortex, hippocampus, and basal midbrain by 4 days post-infection .

  • Chimeric Reporting Systems: For improved safety in some research applications, chimeric systems incorporating WEEV structural genes into Sindbis virus backbones (SINV-WEEV-EGFP) have been developed . These chimeras express reporter proteins like EGFP as structural protein fusions.

These experimental approaches provide powerful tools for investigating the cellular and molecular determinants of WEEV pathogenesis.

How do the structures of recombinant WEEV glycoproteins compare to those in native virions?

Structural analyses have revealed important similarities and differences between recombinant WEEV glycoproteins and their counterparts in native virions:

Understanding these differences is essential for correctly interpreting structural data and designing effective recombinant proteins for research and therapeutic applications.

What computational methods are used to analyze the structure-function relationships of WEEV structural proteins?

Computational approaches have become indispensable for understanding the complex structure-function relationships in WEEV proteins:

  • Homology Modeling: Structural models of WEEV proteins have been developed based on solved structures from related alphaviruses. For example, the orientation of WEEV E1 has been determined using a homology model based on the E1 structure from Semliki Forest virus .

  • Sequence Alignment and Comparative Analysis: Amino acid sequence comparisons between WEEV, EEEV, VEEV, SINV, and other alphaviruses have revealed patterns of conservation that reflect functional constraints and evolutionary relationships. These analyses have confirmed WEEV's recombinant origin and identified regions where compensatory mutations were required to maintain functionality .

  • Molecular Dynamics Simulations: These can predict the conformational dynamics of viral glycoproteins under different conditions, providing insights into fusion mechanisms and antibody interactions.

  • Epitope Prediction: Computational tools can identify potential B-cell and T-cell epitopes on WEEV structural proteins, guiding vaccine development efforts.

  • Receptor Binding Prediction: Based on studies of related alphaviruses like EEEV, computational methods can predict potential receptor-binding sites on WEEV glycoproteins, generating hypotheses that can be experimentally tested .

These computational approaches complement experimental structural biology and provide hypotheses that guide further research.

What role do WEEV structural proteins play in neuroinvasion and neuropathogenesis?

WEEV's neurotropism and ability to cause encephalitis rely on specific properties of its structural proteins:

  • Neuronal Spread Pattern: Studies using recombinant WEEV expressing reporter proteins have tracked viral spread from the olfactory bulb to the entorhinal cortex, hippocampus, and basal midbrain , demonstrating a specific pattern of neuroinvasion.

  • Selective Neuronal Vulnerability: WEEV infection causes selective loss of dopaminergic neurons in the substantia nigra pars compacta , suggesting specific viral-host interactions in these neurons.

  • Protein Aggregation Induction: Remarkably, WEEV infection promotes the formation of proteinase K-resistant protein aggregates that stain positively for phospho-serine129 α-synuclein . This finding suggests a potential mechanistic link between alphavirus infection and neurodegenerative disorders.

  • Glial Activation: WEEV infection triggers activation of microglia and astrocytes, contributing to neuroinflammation. This activation persists for at least 8 weeks post-infection, along with continued dopaminergic neuron loss and gene expression profiles consistent with a neurodegenerative phenotype .

These findings highlight the complex role of WEEV structural proteins in neuropathogenesis and suggest potential connections to long-term neurological sequelae.

What approaches using recombinant WEEV structural proteins have shown promise for vaccine development?

Several recombinant protein-based approaches show potential for WEEV vaccine development:

  • E1 Subunit Vaccines: Previous studies have demonstrated that the E1 glycoprotein can function as an effective subunit vaccine, providing 100% protection in mouse models . Additionally, E1-based vaccines may potentially provide cross-protection against multiple alphaviruses .

  • E2E1 Heterodimer Complexes: The E26KE1 polyprotein, which is proteolytically processed to yield the E2E1 heterodimer, may induce more effective immune responses than E1 alone . This approach mimics the natural presentation of these proteins on the viral surface.

  • Engineered E2E1 Chimeras: Novel constructs encoding E2E1 chimeras connected by flexible linkers eliminate the need for proteolytic processing while maintaining appropriate protein structure . Similar chimeric constructs have successfully produced structurally appropriate proteins in both baculovirus and E. coli expression systems.

  • DNA Vaccine Approaches: cDNA clones of the 26S region encoding the WEEV structural polyprotein placed under cytomegalovirus promoter control have been transfected into tissue culture cells, resulting in functional expression of viral envelope proteins . This demonstrates the feasibility of DNA vaccine approaches targeting the structural polyprotein.

These approaches provide multiple avenues for developing effective vaccines against WEEV, potentially offering protection against this relatively rare but serious pathogen.

How can structural information about WEEV glycoproteins guide therapeutic antibody development?

Structural insights into WEEV glycoproteins provide critical guidance for therapeutic antibody development:

  • Epitope Identification: Structural studies revealing the organization of E1 and E2 on the virion surface help identify accessible epitopes that could be targeted by neutralizing antibodies. The arrangement of these proteins in heterodimers that form trimeric spikes creates complex conformational epitopes spanning multiple proteins .

  • Cross-Reactive Epitope Targeting: Given WEEV's recombinant origin, with E1 and E2 glycoproteins sharing high homology with Sindbis virus (76% and 68% amino acid identity, respectively) , antibodies targeting conserved regions might provide cross-protection against multiple alphaviruses.

  • Receptor-Binding Site Blockade: Structural studies of related alphaviruses like EEEV have identified specific sites on viral glycoproteins that engage host receptors . Antibodies designed to block these interactions could prevent viral entry.

  • Decoy Receptor Development: Structural understanding of receptor-virus interactions has enabled the design of minimal decoy receptors that can neutralize infection. For example, structural and functional analyses of EEEV-VLDLR interactions informed the design of a minimal VLDLR decoy receptor that neutralizes EEEV infection and protects mice from lethal challenge . Similar approaches could be applied to WEEV.

These structure-guided approaches represent promising strategies for developing effective therapeutics against WEEV infection.

How do mutations in WEEV structural proteins affect viral fitness and host range?

The evolution and adaptation of WEEV structural proteins have significant implications for viral fitness and host interactions:

Understanding these evolutionary dynamics is essential for predicting potential changes in WEEV pathogenicity and developing broadly effective countermeasures.

What evidence exists for ongoing recombination events in WEEV evolution?

WEEV's origin as a recombinant virus raises questions about the potential for additional recombination events in its ongoing evolution:

  • Historical Recombination: Phylogenetic analyses have conclusively demonstrated that WEEV arose through recombination between an EEEV-like virus and a Sindbis-like virus . The capsid gene and 3' untranslated region came from an EEEV-like ancestor, while the envelope glycoprotein genes derived from a Sindbis-like virus.

  • WEEV Antigenic Complex: Comparative analysis of viruses in the WEEV antigenic complex suggests additional recombination events subsequent to the emergence of the ancestral chimeric progenitor . For instance, Fort Morgan virus (FMV) and Buggy Creek virus (BCRV) show inconsistent phylogenetic relationships across different viral proteins, suggesting complex evolutionary histories potentially involving multiple recombination events.

  • Experimental Demonstration: While not specific to WEEV, experimental studies with the related salmonid alphavirus (SAV3) have confirmed that alphavirus RNA recombination can occur in vivo . This research documented imprecise homologous recombination creating RNA deletion variants, corresponding with deletion variants found in field isolates.

  • Recombination Hotspots: Analysis of alphavirus genomes suggests that certain regions may be more prone to recombination, potentially due to RNA secondary structure or sequence similarities that facilitate template switching during replication.

These findings highlight the importance of recombination as an ongoing evolutionary mechanism for alphaviruses, with potential implications for WEEV's continued evolution and adaptation.

What are the key unresolved questions about WEEV structural proteins that require further investigation?

Despite significant advances in understanding WEEV structural proteins, several important questions remain unresolved:

  • High-Resolution Structure: While cryo-EM has provided insights into WEEV structure at 13-Å resolution , higher-resolution structures (sub-3Å) are needed to elucidate atomic-level details of protein interactions, glycosylation sites, and potential drug-binding pockets.

  • Host Receptor Identification: Unlike EEEV, which uses VLDLR as a receptor , the specific cellular receptors for WEEV entry remain poorly characterized. Identifying these receptors would provide valuable insights into viral tropism and potential therapeutic targets.

  • Cross-Protection Mechanisms: The extent to which antibodies against WEEV structural proteins provide protection against other alphaviruses needs further investigation, especially given WEEV's recombinant origin with components shared with EEEV and Sindbis virus.

  • Role in Neuroinflammation: While WEEV infection has been linked to neuroinflammation and protein aggregation , the specific mechanisms by which viral structural proteins contribute to these processes remain unclear.

  • Determinants of Virulence: The specific structural features that determine WEEV's neurotropism and variable virulence among different strains require further characterization.

Addressing these questions will advance our understanding of WEEV biology and inform the development of effective countermeasures.

What emerging technologies could advance research on WEEV structural proteins?

Several cutting-edge technologies hold promise for advancing WEEV structural protein research:

  • Cryo-Electron Tomography: This technique could visualize WEEV-host interactions at the cellular level, providing insights into virus entry, assembly, and budding processes that are difficult to capture with other methods.

  • AlphaFold and Other AI Prediction Tools: Machine learning approaches for protein structure prediction could complement experimental techniques, particularly for predicting structures of WEEV proteins in different conformational states.

  • Single-Particle Tracking: Advanced fluorescence microscopy techniques could track individual virions during cellular entry and transport, providing real-time visualization of structural protein functions during infection.

  • CRISPR-Based Screening: Genome-wide screens could identify host factors that interact with WEEV structural proteins during different stages of the viral life cycle.

  • Microfluidic Organ-on-Chip Systems: These could model the blood-brain barrier and neural tissues to study WEEV neuroinvasion mechanisms in physiologically relevant systems without requiring animal models.

  • CryoAPEX and In-Cell Structural Biology: These emerging approaches could capture structures of viral proteins in their native cellular environment, providing context-dependent structural information.

These technologies, individually and in combination, offer powerful new approaches to address fundamental questions about WEEV structural proteins and their roles in viral pathogenesis.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.