Recombinant Whitewater arroyo virus Pre-glycoprotein polyprotein GP complex (GPC)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
GPC; GP-C; Pre-glycoprotein polyprotein GP complex; Pre-GP-C
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
247-480
Protein Length
Full Length of Mature Protein
Species
Whitewater Arroyo mammarenavirus (isolate Rat/United States/AV 9310135/1995) (WWAV)
Target Names
GPC
Target Protein Sequence
SFFAWSLSDATGTDMPGGYCLEKWMLISSELKCFGNTAIAKCNLDHSSEFCDMLKLFEFN RNAIKTLQNDSKHQLDMIITAVNSLISDNTLMKNRLKELINIPYCNYTKFWYVNHTGFNV HSLPRCWLTKNGSYLNVSDFRNQWLLESDHLISEILSREYEARQGKTPLGLVDVCFWSTL FYVSSIFLHLLRIPTHRHIIGEGCPKPHRLSSNSVCACGLFKQKGRPLRWAGKV
Uniprot No.

Target Background

Function
The Recombinant Whitewater arroyo virus Pre-glycoprotein polyprotein GP complex (GPC) is a class I viral fusion protein. It mediates fusion between viral and host endosomal membranes, delivering the nucleocapsid into the cytoplasm. This membrane fusion is driven by irreversible conformational changes triggered by endosomal acidification. The stable signal peptide (SSP) is cleaved, functioning as a signal peptide and remaining as a GP complex component. SSP is crucial for efficient glycoprotein expression, post-translational GP1/GP2 cleavage, glycoprotein transport to the plasma membrane, infectious virion formation, and acid pH-dependent cell fusion. The GPC also interacts with the host receptor.
Database Links

KEGG: vg:6301278

Protein Families
Arenaviridae GPC protein family
Subcellular Location
[Glycoprotein G1]: Virion membrane; Peripheral membrane protein. Host endoplasmic reticulum membrane; Peripheral membrane protein. Host Golgi apparatus membrane; Peripheral membrane protein. Host cell membrane; Peripheral membrane protein.; [Glycoprotein G2]: Virion membrane; Single-pass membrane protein. Host endoplasmic reticulum membrane; Single-pass membrane protein. Host Golgi apparatus membrane; Single-pass membrane protein. Host cell membrane; Single-pass membrane protein.; [Stable signal peptide]: Virion membrane; Multi-pass membrane protein. Host endoplasmic reticulum membrane; Multi-pass membrane protein. Host Golgi apparatus membrane; Multi-pass membrane protein. Host cell membrane; Multi-pass membrane protein.

Q&A

What is the Whitewater Arroyo virus and how was it first identified?

Whitewater Arroyo virus (WWAV) is a North American New World arenavirus first isolated from wood rats in New Mexico in 1993, named after the location where it was discovered . It belongs to the family Arenaviridae and the Tacaribe serocomplex. The virus was initially identified by Charles Fulhorst and colleagues at the University of Texas Medical Branch (UTMB) in Galveston during studies of rodent populations in western U.S. states . WWAV gained greater attention after being tentatively associated with three human fatalities in California during 1999-2000, including a confirmed case of a 14-year-old girl from Alameda County in Northern California . This discovery represented a significant finding as it established WWAV as a potential human pathogen within North America.

What is the pre-glycoprotein polyprotein GP complex (GPC) and what is its significance in viral function?

The pre-glycoprotein polyprotein GP complex (GPC) is a crucial structural and functional component of the Whitewater Arroyo virus. Similar to other arenaviruses, the GPC is initially synthesized as a polyprotein precursor that undergoes post-translational processing to generate the mature glycoprotein components . These components include a stable signal peptide (SSP) and the glycoproteins G1 and G2, which together form the viral spikes on the surface of the virion . The GPC is primarily responsible for mediating virus attachment to cellular receptors and facilitating viral entry into host cells through membrane fusion . Additionally, the GPC is a major determinant of viral tropism and pathogenicity, as it dictates which cell types the virus can infect based on receptor recognition patterns . Understanding the structure and function of the WWAV GPC is therefore essential for elucidating the virus's life cycle and pathogenic potential.

What is the molecular composition and organization of the WWAV GPC?

The WWAV GPC is organized as a complex protein structure composed of multiple functional domains. Based on studies of related arenaviruses, the WWAV GPC is likely synthesized as a single polyprotein precursor that undergoes proteolytic processing to yield three main components: the stable signal peptide (SSP), glycoprotein G1, and glycoprotein G2 . The SSP, unlike conventional signal peptides that are typically discarded after protein translocation, is retained as an essential third component of the mature GP complex . The G1 subunit forms the receptor-binding domain that mediates attachment to host cell receptors, while G2 functions as the fusion protein that facilitates membrane fusion during viral entry . Together, these three components (SSP, G1, and G2) assemble into trimeric spike structures on the viral surface, where they form connections with the underlying viral matrix . The specific amino acid sequence of the WWAV GPC, particularly in regions responsible for receptor binding, determines its host range and cell tropism.

How does the recombinant nature of WWAV's genome influence the structure and function of its GPC?

The recombinant nature of WWAV's genome has profound implications for the structure and function of its GPC. Genetic analyses have demonstrated that the WWAV genome is a product of recombination between two different Tacaribe complex viruses, with its nucleoprotein (N) gene descended from a lineage A virus and its GPC gene from a lineage B virus . This unique evolutionary history means that the WWAV GPC shares greater similarity with the GPCs of clade B arenaviruses than with those of clade A . This recombination event likely occurred through co-infection of a host animal with two different arenaviruses, leading to genetic exchange and the emergence of WWAV with its hybrid genome . The functional consequences of this recombination are significant, as the clade B-like GPC determines the virus's receptor usage patterns, which differ from both typical clade A and pathogenic clade B viruses . Specifically, while pathogenic clade B viruses typically use the human transferrin receptor 1 (hTfR1) for cell entry, studies have shown that WWAV GPC does not utilize this receptor, suggesting it employs an alternative, currently unidentified receptor .

Which cellular receptors does the WWAV GPC utilize for host cell entry?

The WWAV GPC exhibits a distinctive receptor usage pattern that differs from both pathogenic and non-pathogenic arenaviruses. Research using pseudotyped retroviral vectors displaying the WWAV GPC has demonstrated that it does not utilize the human transferrin receptor 1 (hTfR1), which is the primary receptor used by pathogenic New World clade B arenaviruses such as Junín and Machupo viruses . Additionally, studies have shown that WWAV GPC also does not employ α-dystroglycan (α-DG), which serves as the main receptor for Old World arenaviruses like Lassa virus and lymphocytic choriomeningitis virus (LCMV) . These findings suggest that WWAV GPC must recognize an alternative, currently unidentified cellular receptor for entry . This pattern of receptor usage is similar to that observed for other non-pathogenic clade B arenaviruses, such as Tacaribe virus (TCRV) and Amapari virus (AMAV), which also appear to use unidentified receptors . The identification of this unknown receptor represents an important area for future research, as it may provide insights into the host range, tissue tropism, and pathogenic potential of WWAV.

What methodological approaches are used to study WWAV GPC receptor interactions?

Several sophisticated methodological approaches are employed to investigate WWAV GPC receptor interactions. A primary technique involves the use of pseudotyped retroviral vectors displaying the WWAV GPC on their surface . These vectors contain a GFP reporter gene, allowing researchers to quantitatively assess viral entry into different cell types through flow cytometry analysis at 48 hours post-transduction . By testing the ability of these pseudotyped vectors to transduce various cell lines derived from different tissues and species, researchers can establish tropism patterns that provide clues about receptor usage . This approach has revealed distinct transduction patterns for WWAV GP compared to other arenavirus GPs, suggesting unique receptor preferences . Complementary approaches include competitive binding assays, where soluble receptors or receptor-blocking antibodies are used to inhibit viral entry, and direct binding assays using purified GPC and receptor proteins. Additionally, researchers employ genetic approaches, such as gene knockout or knockdown studies, to identify cellular factors required for WWAV entry. For example, studies have demonstrated that WWAV GP-mediated entry is not impaired in cells lacking expression of known arenavirus receptors like hTfR1 or α-DG, confirming that it utilizes alternative entry pathways . Finally, cell-cell fusion assays, where cells expressing WWAV GPC are co-cultured with receptor-bearing target cells under various pH conditions, can provide insights into the fusion mechanism and pH dependence of WWAV entry.

How does the GPC contribute to WWAV virulence and host range?

The GPC plays a central role in determining WWAV virulence and host range through several mechanisms. As the primary mediator of receptor binding, the GPC dictates which cell types and host species the virus can infect . The specific receptor preference of WWAV GPC, which differs from both pathogenic and non-pathogenic arenaviruses, likely influences its tissue tropism and pathogenic potential . Studies using pseudotyped viral vectors have shown that WWAV GPC exhibits a transduction pattern in various cell lines that resembles that of non-pathogenic rather than pathogenic clade B arenaviruses, potentially explaining its limited pathogenicity in humans . Furthermore, the GPC's fusion activity, which is necessary for viral entry into cells, is regulated by pH and potentially other cellular factors, affecting the efficiency of viral replication in different cellular environments . The recombinant nature of WWAV GPC, having originated from a clade B virus through recombination, may have conferred unique properties that influence its virulence profile . Additionally, interactions between the GPC and the host immune system likely shape the outcome of infection. While not specifically documented for WWAV, studies of related arenaviruses suggest that the GPC may modulate host immune responses, potentially through interference with receptor signaling pathways or by serving as a target for neutralizing antibodies . Understanding these complex interactions between WWAV GPC and host factors is essential for assessing the virus's zoonotic potential and developing effective countermeasures.

What in vitro and in vivo models are most appropriate for studying WWAV GPC functions?

Several complementary in vitro and in vivo models can be employed to study WWAV GPC functions comprehensively. In vitro, pseudotyped retroviral vectors displaying WWAV GPC provide a valuable system for investigating viral entry mechanisms without the need for high-containment facilities . These vectors encode a GFP reporter gene, allowing for quantitative assessment of transduction efficiency across different cell lines . Cell lines derived from various tissues and species can reveal the cellular tropism conferred by WWAV GPC, providing insights into potential sites of viral replication in vivo . For studying the complete viral life cycle, reverse genetics systems that allow the generation of recombinant WWAV from cloned cDNA would be valuable, though such systems have not been explicitly described for WWAV in the provided search results. In vivo, the natural host Neotoma albigula (white-throated woodrat) offers an authentic model for studying WWAV-host interactions . Experimental infection studies in woodrats have demonstrated that these animals develop asymptomatic infections with age-dependent differences in viral persistence, making them suitable for investigating factors affecting viral clearance and persistence . For human disease modeling, immunocompromised mouse models or mice expressing human cellular receptors might be developed, similar to those used for other arenaviruses. Additionally, organ-on-chip technologies and three-dimensional tissue culture systems could bridge the gap between conventional cell culture and animal models by providing more physiologically relevant environments for studying WWAV GPC-mediated entry and virus-host interactions.

What antiviral approaches target the WWAV GPC specifically?

Antiviral approaches targeting the WWAV GPC specifically have not been extensively documented, but several strategies based on knowledge of related arenaviruses could be effective. One potential approach involves the development of small molecule inhibitors that target the pH-dependent conformational changes in the GPC required for membrane fusion . Such fusion inhibitors would prevent the release of viral contents into the cell cytoplasm, effectively blocking viral replication at an early stage. Another strategy could focus on receptor antagonists that competitively inhibit the interaction between WWAV GPC and its cellular receptor . Although the specific receptor for WWAV remains unidentified, once characterized, soluble receptor decoys or antibodies targeting the receptor-binding domain of the GPC could be developed . Additionally, broadly neutralizing antibodies targeting conserved epitopes within the WWAV GPC could provide both therapeutic and prophylactic benefits. Such antibodies might recognize regions of the GPC that are functionally constrained and therefore less prone to escape mutations. Peptide inhibitors derived from the fusion peptide or heptad repeat regions of the G2 subunit could also disrupt the fusion machinery by preventing the formation of the six-helix bundle structure required for membrane fusion. For therapeutic applications, ribavirin, a broad-spectrum antiviral that has shown efficacy against other arenaviruses, might be effective against WWAV infections and has been suggested as a potential treatment option .

How can knowledge of WWAV GPC structure inform vaccine development?

Understanding the structure of WWAV GPC can significantly inform vaccine development strategies through several approaches. Detailed structural characterization can identify conserved epitopes that elicit broadly neutralizing antibodies, which could protect against not only WWAV but potentially other related arenaviruses . Recombinant subunit vaccines based on the WWAV GPC, particularly focusing on the receptor-binding domain of G1 and immunodominant regions of G2, could induce protective immunity without the risks associated with live virus vaccines . The availability of recombinant WWAV GPC proteins expressed in E. coli with His tags provides a foundation for such subunit vaccine approaches . Additionally, pseudotyped viral vectors or virus-like particles displaying the WWAV GPC could serve as safe and immunogenic vaccine platforms that mimic the native presentation of viral antigens . Structure-based rational design could also enable the development of modified GPC constructs with enhanced stability, immunogenicity, or expression levels. For example, engineering stabilizing mutations that lock the GPC in its pre-fusion conformation might better preserve neutralizing epitopes. Chimeric GPC constructs combining regions from WWAV and other arenaviruses could potentially elicit broader protection. Furthermore, understanding the structural basis of WWAV's non-pathogenic phenotype compared to related pathogenic arenaviruses might allow for the development of live-attenuated vaccine candidates with favorable safety profiles. Given WWAV's recombinant nature, with a clade B-like GPC, vaccines targeting this protein might provide cross-protection against more pathogenic clade B arenaviruses that cause hemorrhagic fevers in South America .

What methodological challenges exist in developing diagnostics for WWAV infections?

Developing diagnostics for WWAV infections presents several methodological challenges that researchers must address. A primary challenge is the limited availability of clinical samples from confirmed human WWAV infections, which hampers the validation of diagnostic tests . The tentative association with only three human cases makes it difficult to establish the sensitivity and specificity of diagnostic assays across the spectrum of clinical presentations . Another significant challenge involves distinguishing WWAV from related arenaviruses, particularly given its recombinant nature with genomic segments derived from different viral lineages . Molecular diagnostics based on nucleic acid detection must target conserved regions within the WWAV genome while maintaining specificity to avoid cross-reactivity with other arenaviruses. Serological diagnostics face the additional challenge of potential cross-reactivity between antibodies against WWAV and those against other arenaviruses, necessitating the identification of WWAV-specific epitopes within the GPC or other viral proteins . The development of rapid diagnostic tests, which would be valuable for timely clinical intervention, is complicated by the presumed low prevalence of WWAV infections and the nonspecific early symptoms that may resemble other febrile illnesses . Researchers are working to address these challenges, with efforts focused on developing more sensitive molecular detection methods. For instance, Fulhorst and colleagues have been working on a rapid test to detect arenavirus infections, which could potentially help diagnose WWAV infections in a timely manner . Continued research on the structural and antigenic properties of WWAV GPC will be essential for overcoming these diagnostic challenges and developing specific, sensitive, and rapid tests for WWAV infections.

What are the most pressing unresolved questions regarding WWAV GPC structure and function?

Several critical unresolved questions regarding WWAV GPC structure and function warrant focused research attention. Perhaps the most pressing question is the identity of the cellular receptor(s) utilized by WWAV for entry into host cells . Unlike pathogenic clade B arenaviruses that use hTfR1 or Old World arenaviruses that employ α-DG, WWAV appears to use an alternative, currently unidentified receptor . Identifying this receptor would provide fundamental insights into WWAV's tissue tropism, host range, and pathogenic potential. Another significant question concerns the high-resolution three-dimensional structure of the WWAV GPC in both its pre-fusion and post-fusion conformations. While the general organization of arenavirus GPCs has been determined for some species, WWAV-specific structural details could reveal unique features that influence its function and immunogenicity. Additionally, the precise fusion mechanism of WWAV GPC remains to be fully characterized, including the specific triggers for conformational changes and the structural rearrangements that drive membrane fusion . The molecular determinants that dictate WWAV's apparent limited pathogenicity in humans, despite its genetic relationship to pathogenic clade B arenaviruses, represent another important area for investigation . Further research is also needed to understand the evolutionary history of WWAV's recombinant genome and the functional implications of its hybrid nature, particularly how the clade B-derived GPC interacts with other viral components derived from clade A viruses . Finally, the potential for WWAV to undergo further evolution that might enhance its pathogenicity or transmissibility remains an open question with significant public health implications.

How might advanced technologies enhance our understanding of WWAV GPC?

Advanced technologies across multiple disciplines offer promising avenues to enhance our understanding of WWAV GPC. Cryo-electron microscopy (cryo-EM) could reveal the high-resolution structure of the entire WWAV virion, including the arrangement of GPC spikes on the viral surface, potentially identifying unique features compared to other arenaviruses . Single-particle cryo-EM of purified GPC trimers could elucidate the precise molecular architecture of the protein in its pre-fusion state, while time-resolved studies might capture intermediate conformations during the fusion process. Complementary structural techniques such as X-ray crystallography and hydrogen-deuterium exchange mass spectrometry could provide additional insights into specific domains and dynamic regions of the GPC. Advanced genomic and transcriptomic approaches could help trace the evolutionary history of WWAV's recombinant genome and investigate host responses to infection . CRISPR-Cas9 genome-wide screens in susceptible cell lines could identify host factors required for WWAV entry, potentially revealing the elusive receptor(s) . Protein-protein interaction studies using techniques like proximity labeling, co-immunoprecipitation coupled with mass spectrometry, or surface plasmon resonance could directly identify cellular binding partners of WWAV GPC. Advanced imaging technologies, including super-resolution microscopy and live-cell imaging, could track the dynamics of WWAV entry in real-time, providing insights into the kinetics and cellular compartments involved in the entry process. Finally, computational approaches including molecular dynamics simulations and machine learning algorithms could predict conformational changes in the GPC during fusion, identify potential epitopes for neutralizing antibodies, and guide the rational design of antivirals targeting the GPC.

What collaborative research initiatives could accelerate WWAV GPC research?

Multidisciplinary collaborative research initiatives could significantly accelerate progress in understanding WWAV GPC and developing countermeasures against potential infections. An international consortium bringing together virologists, structural biologists, immunologists, and clinicians would facilitate the comprehensive characterization of WWAV GPC from molecular to organismal levels. Such a consortium could establish a centralized repository of WWAV reagents, including recombinant proteins, pseudotyped vectors, and monoclonal antibodies, making these resources widely available to the research community . Collaborative efforts between academic institutions and public health agencies could enhance surveillance for WWAV in rodent populations and potential human cases, generating valuable epidemiological data and clinical samples for diagnostic development . Partnerships between structural biology groups and computational biology teams could accelerate the determination and analysis of WWAV GPC structures, potentially identifying druggable sites for therapeutic development. Collaborations with pharmaceutical companies could leverage high-throughput screening technologies to identify small molecule inhibitors targeting WWAV GPC, while partnerships with vaccine developers could translate structural insights into novel vaccine candidates. Interdisciplinary projects involving ecologists, evolutionary biologists, and virologists could investigate the factors driving WWAV evolution and transmission dynamics in natural host populations, providing context for understanding its zoonotic potential . Finally, establishing connections with researchers studying related arenaviruses would facilitate comparative analyses that could reveal conserved and unique features of WWAV GPC, potentially leading to broadly effective countermeasures against multiple arenaviruses. By fostering such collaborative initiatives, the scientific community could more rapidly advance our understanding of WWAV GPC and develop strategies to mitigate potential public health risks associated with this virus.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.