Recombinant Wolbachia pipientis subsp. Culex pipiens Glycerol-3-phosphate acyltransferase (plsY)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Wolbachia pipientis subsp. Culex pipiens Glycerol-3-phosphate Acyltransferase (PlsY)

Recombinant Wolbachia pipientis subsp. Culex pipiens Glycerol-3-phosphate acyltransferase (PlsY) is a bacterial enzyme involved in the biosynthesis of phospholipids, a critical process for membrane formation in prokaryotes. PlsY catalyzes the transfer of an acyl group from acyl-phosphate to glycerol-3-phosphate (G3P), forming lysophosphatidic acid (LPA), the first committed step in glycerolipid synthesis . This enzyme is essential for Wolbachia’s survival, as it supports membrane integrity and energy metabolism within its arthropod host . The recombinant form of PlsY is engineered for biochemical studies, enabling insights into Wolbachia’s metabolic dependencies and potential applications in vector-borne disease control .

Protein Architecture

  • Gene and Sequence: The plsY gene (UniProt ID: B3CMU6) encodes a 191-amino-acid protein with five transmembrane domains . Key conserved motifs include a phosphate-binding loop (motif 2) and catalytic residues such as serine and arginine (motif 1) .

  • AlphaFold Model: Computed structural modeling (AF_AFB3CMU6F1) predicts high confidence (pLDDT: 97.1), with an α-helical core and cytoplasmic active sites .

Enzymatic Mechanism

PlsY operates via a two-step process:

  1. Acylphosphate Formation: Acyl groups are transferred from acyl-ACP to phosphate via PlsX .

  2. Acyl Transfer: PlsY transfers the acyl group to G3P, producing LPA .
    This pathway is distinct from eukaryotic GPATs, which directly use acyl-CoA .

Key Features

PropertySpecificationSource
Molecular Weight~21 kDa (calculated)
Expression SystemE. coli (recombinant)
Storage ConditionsTris buffer, 50% glycerol, -20°C/-80°C
InhibitorsPalmitoyl-CoA (noncompetitive)

Role in Wolbachia Symbiosis

  • Metabolic Dependency: Wolbachia lacks lipid A synthesis genes, relying on host-derived lipids and enzymes like PlsY for membrane lipid production .

  • Host Manipulation: Wolbachia’s lipid metabolism intersects with host glycogen regulation via GSK3β signaling, influencing symbiont proliferation and host immunity .

Comparative Analysis

  • Bacterial vs. Eukaryotic GPATs: Unlike eukaryotic GPATs (e.g., GPAT1-4 in mammals), PlsY uses acyl-phosphate instead of acyl-CoA, reflecting evolutionary divergence in lipid synthesis .

  • Homologs: Rhizobium loti PlsY (UniProt Q98M84) shares 34% sequence identity, highlighting conserved catalytic residues .

Implications for Disease Control

  • Vector Competence: Wolbachia-infected mosquitoes exhibit reduced pathogen transmission. Targeting PlsY could disrupt symbiont fitness, enhancing vector control strategies .

  • In Vitro Studies: Competitive assays show Wolbachia strains like wMel outcompete others (wRi) in host cells, underscoring metabolic efficiency as a fitness determinant .

Future Directions

  • Structural Studies: Crystallization of recombinant PlsY could refine inhibitor design .

  • Host-Pathogen Dynamics: Investigating PlsY’s interaction with host lipid pathways may reveal novel targets for antiparasitic therapies .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format that we currently have in stock. However, if you have any specific format requirements, please indicate them in your order notes. We will do our best to fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a final concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can be used as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer components, storage temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
If you require a specific tag type, please inform us, and we will prioritize its development.
Synonyms
plsY; WP1110; Glycerol-3-phosphate acyltransferase; Acyl-PO4 G3P acyltransferase; Acyl-phosphate--glycerol-3-phosphate acyltransferase; G3P acyltransferase; GPAT; Lysophosphatidic acid synthase; LPA synthase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-191
Protein Length
full length protein
Species
Wolbachia pipientis subsp. Culex pipiens (strain wPip)
Target Names
plsY
Target Protein Sequence
MEKYIILILSYVIGSIPFSLIIAKINGINLREVGSGNIGATNVARTGNKRLAVLALFLDS LKGFVAVYTAQQFCDNNDLYIYVSAILAVLGHMFPIWLRFNGGKGVATTLGVLIALNISI ALAFVFVWLIVFFIFRYSSLASLAATAAAVIASFFFQKELFLILLTVAILIFLKHYKNIA NLLQGRERKFL
Uniprot No.

Target Background

Function
This enzyme catalyzes the transfer of an acyl group from acyl-phosphate (acyl-PO(4)) to glycerol-3-phosphate (G3P) to form lysophosphatidic acid (LPA). It utilizes acyl-phosphate as the fatty acyl donor, but not acyl-CoA or acyl-ACP.
Database Links

KEGG: wpi:WP1110

STRING: 570417.WPa_1110

Protein Families
PlsY family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the primary function of Glycerol-3-phosphate acyltransferase (plsY) in Wolbachia pipientis?

Glycerol-3-phosphate acyltransferase (plsY) in Wolbachia pipientis functions as an integral membrane protein that catalyzes the transfer of acyl groups from acylphosphate to glycerol-3-phosphate, forming lysophosphatidic acid. This reaction represents a critical step in bacterial membrane phospholipid biosynthesis . In the most widely distributed bacterial pathway, plsY works in concert with PlsX, which converts acyl-acyl carrier protein to acylphosphate, with plsY then completing the transfer to glycerol-3-phosphate . This process initiates the synthesis of phosphatidic acid, which serves as the precursor for membrane phospholipids essential for bacterial cell structure and function.

How does the membrane topology of plsY influence its enzymatic function?

The membrane topology of plsY significantly impacts its enzymatic function through specific structural arrangements. Studies on Streptococcus pneumoniae PlsY reveal that the protein contains five membrane-spanning segments with the amino terminus and two short loops located on the external face of the membrane . The three larger cytoplasmic domains each contain highly conserved sequence motifs critical for catalysis. This arrangement positions the active site within the cytoplasmic domains while anchoring the enzyme in the membrane where it can access both the water-soluble glycerol-3-phosphate and membrane-associated acyl substrates . This topology allows plsY to function at the interface between aqueous and lipid environments, facilitating the initial steps of membrane lipid synthesis.

What conserved domains characterize the plsY enzyme family?

The plsY enzyme family is characterized by three highly conserved sequence motifs, each with distinct functional roles:

MotifKey ResiduesFunctionEffect of Mutation
Motif 1Serine, ArginineEssential for catalysisLoss of enzyme activity
Motif 2Conserved glycinesGlycerol-3-phosphate bindingIncreased Km for G3P
Motif 3Histidine, Asparagine, GlutamateActivity and structural integrityReduced activity and protein instability

Site-directed mutagenesis studies have demonstrated that each domain is critical for plsY function. Specifically, Motif 1 contains essential serine and arginine residues required for catalytic activity. Motif 2 exhibits characteristics of a phosphate-binding loop, with mutations of conserved glycines resulting in defective glycerol-3-phosphate binding. Motif 3 includes a conserved histidine and asparagine important for activity, plus a glutamate critical to the structural integrity of the entire protein .

How might recombination between different Wolbachia strains affect plsY gene function and evolution?

Recombination between different Wolbachia strains could significantly impact plsY gene function and evolution through several mechanisms. Although Wolbachia recombination events are relatively rare (approximately 1 in 500,000 alignments in laboratory conditions), they increase in frequency when strains co-occur for extended periods . These recombination events can generate novel plsY variants with potentially altered substrate specificity, catalytic efficiency, or regulatory properties.

The recombination process is likely mediated through passive mechanisms such as homology-directed repair with divergent strain extracellular DNA, requiring high concentrations of multiple strains and extended co-culture times . In mixed infections of wMel and wRi strains, the highest recombinant fractions occurred when strains co-existed the longest, particularly in 1:1000 S2 mixtures . For plsY specifically, recombination could lead to adaptive modifications that optimize the enzyme's function in different host environments or in response to selective pressures.

These recombination dynamics are particularly relevant for understanding plsY evolution across the diverse range of hosts infected by Wolbachia, from arthropods to nematodes, where the enzyme may need to adapt to different cellular environments and metabolic contexts.

What role might plsY play in Wolbachia's ability to manipulate host reproduction?

While the direct connection between plsY and reproductive manipulation is not explicitly established in the search results, several mechanisms can be proposed based on Wolbachia biology. Wolbachia pipientis is renowned for its ability to manipulate host reproduction through mechanisms such as cytoplasmic incompatibility, parthenogenesis, feminization, and male killing . As a key enzyme in bacterial membrane phospholipid biosynthesis, plsY could influence these reproductive manipulations through:

  • Membrane composition effects: Changes in Wolbachia membrane composition via plsY activity could alter bacterial surface proteins that interact with host reproductive tissues.

  • Metabolic interactions: Phospholipid synthesis pathways affected by plsY may produce signaling molecules that interfere with host hormonal or developmental pathways.

  • Energy allocation: The efficient functioning of plsY contributes to proper bacterial membrane formation, potentially affecting Wolbachia's energy budget and ability to produce factors that manipulate host reproduction.

  • Bacterial density effects: Proper membrane synthesis via plsY is essential for Wolbachia replication, which correlates with the strength of reproductive manipulation phenotypes . The wMelPop variant, which infects at higher titers, shows stronger phenotypic effects in hosts compared to lower-titer strains .

Future research should investigate whether inhibition or modification of plsY activity impacts Wolbachia's reproductive manipulation capabilities.

How does plsY function differ between Wolbachia strains that infect arthropods versus those that infect nematodes?

Wolbachia pipientis evolved after the divergence of arthropods and nematodes, but has successfully infected high proportions of both taxa through different evolutionary strategies . The plsY enzyme likely plays distinct roles in these different host contexts:

In arthropod-infecting Wolbachia strains, plsY function may be optimized for:

  • Rapid adaptation to new host environments, supporting Wolbachia's ability to "jump" to new hosts via horizontal transmission

  • Competitive dynamics in mixed infections, where different strains must compete or coexist

  • Support for reproductive manipulation phenotypes that enhance maternal transmission

In nematode-infecting Wolbachia strains, plsY function may be adapted for:

  • Long-term co-evolutionary relationships, as these strains exhibit more stable patterns of association with their hosts

  • Mutualistic rather than parasitic interactions, potentially producing membrane lipids that benefit both symbiont and host

  • Supporting higher bacterial densities in specific host tissues

These functional differences may be reflected in sequence variations, expression patterns, or regulatory mechanisms affecting plsY across Wolbachia strains adapted to different host types. Comparative genomic and biochemical analyses would be valuable for characterizing these potential adaptations.

What are the optimal expression systems and purification strategies for recombinant Wolbachia pipientis plsY?

The optimal expression and purification of recombinant Wolbachia pipientis plsY requires specialized approaches due to its nature as a membrane-integrated protein with multiple transmembrane domains. Based on methodologies applied to similar proteins, researchers should consider:

Expression Systems:

  • E. coli strains optimized for membrane proteins: C41(DE3), C43(DE3), or Lemo21(DE3) strains that tolerate membrane protein toxicity

  • Insect cell expression systems: Such as Sf9 or High Five cells, which may provide more native-like membrane environments

  • Cell-free expression systems: Particularly those supplemented with lipid nanodiscs or detergent micelles to support membrane protein folding

Expression Optimization:

  • Temperature modulation: Lower temperatures (16-20°C) to slow expression and improve folding

  • Induction conditions: Lower IPTG concentrations (0.1-0.5 mM) for gentler induction

  • Fusion tags: N-terminal fusions such as MBP or SUMO that improve folding and solubility

Purification Strategies:

  • Detergent screening: Systematic testing of mild detergents (DDM, LDAO, LMNG) for optimal extraction

  • Two-step chromatography: Affinity purification followed by size exclusion chromatography

  • Reconstitution: Transfer into lipid nanodiscs or proteoliposomes for functional studies

The purified protein should be verified using Western blotting, mass spectrometry, and activity assays specific to glycerol-3-phosphate acyltransferase function, measuring the formation of lysophosphatidic acid from glycerol-3-phosphate and acyl donors.

What techniques are most effective for studying plsY enzyme kinetics and substrate specificity?

Several sophisticated techniques can be employed to characterize plsY enzyme kinetics and substrate specificity:

In vitro enzyme assay approaches:

  • Radiometric assays: Using radiolabeled substrates (14C-glycerol-3-phosphate or 14C-acyl donors) to track product formation

  • Fluorescence-based assays: Developing fluorescent substrate analogs or coupling reactions to NAD(P)H-dependent steps for continuous monitoring

  • Mass spectrometry: LC-MS/MS to identify and quantify reaction products with high sensitivity

Substrate specificity determination:

  • Substrate panel testing: Systematic evaluation of acyl chain lengths (C8-C20) and saturation states

  • Competition assays: Using mixtures of potential substrates to determine preferences

  • Site-directed mutagenesis: Altering residues in the three key motifs, particularly in Motif 2 which affects glycerol-3-phosphate binding

Kinetic analysis methodologies:

  • Initial velocity measurements: Determining Km and Vmax for each substrate under varied conditions

  • Inhibition studies: Using palmitoyl-CoA, which has been shown to noncompetitively inhibit plsY , and other potential inhibitors

  • pH and temperature dependence: Evaluating optimal conditions and stability profiles

For membrane-integrated enzymes like plsY, proper preparation of the protein in appropriate membrane mimetics (detergent micelles, nanodiscs, or proteoliposomes) is crucial for obtaining physiologically relevant kinetic parameters.

How can researchers effectively verify the successful horizontal gene transfer of recombinant plsY between Wolbachia strains?

Verifying horizontal gene transfer of recombinant plsY between Wolbachia strains requires a multi-faceted approach combining genomic, transcriptomic, and functional analyses:

Genomic detection methods:

  • Whole genome sequencing: Deep sequencing to detect chimeric sequences containing signatures from multiple strains

  • PCR-based detection: Strain-specific primers flanking the plsY gene region to amplify potential recombinants

  • Digital droplet PCR: Quantifying recombination frequencies with higher sensitivity than traditional PCR

  • Long-read sequencing: Technologies like PacBio or Oxford Nanopore to capture larger recombination segments

Experimental design considerations:

  • Co-culture different Wolbachia strains under conditions that promote recombination (higher concentrations and longer co-culture times)

  • The highest recombinant fractions were observed in 1:1000 S2 mixtures with extended co-existence periods

  • Expect recombination to be rare (approximately 1 in 500,000 alignments) under laboratory conditions

Transcriptomic and functional validation:

  • RNA-seq to verify expression of recombinant plsY variants

  • Comparative enzymatic assays to detect altered substrate preference or activity

  • Host phenotypic changes that might result from altered plsY function

Verification MethodDetection ThresholdAdvantagesLimitations
Whole genome sequencing~1% frequencyComprehensive coverageExpensive, complex analysis
PCR-based detection~0.1-1% frequencyTargeted, cost-effectiveMay miss unexpected recombinations
Digital droplet PCR~0.01% frequencyHighly sensitive quantificationRequires specific primers
Long-read sequencing~5% frequencyCaptures large recombination eventsLower throughput

These approaches collectively provide robust evidence for horizontal gene transfer of plsY between Wolbachia strains.

What experimental designs are most appropriate for studying the impact of plsY mutations on Wolbachia-host interactions?

To effectively study how plsY mutations impact Wolbachia-host interactions, researchers should implement experimental designs that capture both bacterial and host phenotypes:

Mutation generation strategies:

  • Recombination-based approaches: Leverage natural recombination between Wolbachia strains to generate plsY variants

  • Heterologous expression: Express wild-type and mutant plsY in suitable bacterial systems for initial characterization

  • Conditional expression systems: Develop inducible systems to control plsY expression levels in Wolbachia

Host system selection:

  • Cell culture models: Drosophila cell lines (S2 cells) support Wolbachia infection and allow controlled experiments

  • Drosophila model systems: Well-characterized genetic backgrounds enable isolation of plsY effects

  • Mosquito systems: Particularly relevant for studying vector control applications

Phenotypic analyses:

  • Wolbachia titer quantification: qPCR to measure bacterial densities in different host tissues

  • Host transcriptome analysis: RNA-seq to detect host responses to different plsY variants

  • Membrane lipid profiling: Lipidomics to characterize changes in bacterial and host membrane composition

  • Reproductive phenotyping: Assessing cytoplasmic incompatibility strength and other reproductive manipulations

  • Recombination rate analysis: Measure host genetic recombination rates, which can be altered by Wolbachia infection

Control considerations:

  • Multiple Wolbachia strains: Compare effects across wMel, wRi, and wMelPop, which show different host interactions

  • Wolbachia-free controls: Use tetracycline-treated lines to establish baselines

  • Other endosymbionts as outgroups: Compare with Spiroplasma, which does not induce the same recombination effects as Wolbachia

This multi-level experimental approach enables comprehensive characterization of how plsY mutations affect the complex Wolbachia-host relationship at molecular, cellular, and organismal levels.

What potential applications exist for engineered Wolbachia plsY in vector control strategies?

Engineered Wolbachia plsY holds promising potential for vector control strategies through several mechanisms:

Mechanism-based applications:

  • Enhanced Wolbachia establishment: Optimized plsY could improve Wolbachia's ability to establish in novel vector species by facilitating better adaptation to host cell environments

  • Strain competition manipulation: Engineered plsY could potentially influence competitive dynamics between Wolbachia strains, favoring strains with desired properties for vector control

  • Metabolic integration: Modified plsY could alter membrane composition in ways that enhance Wolbachia's effects on host vector capacity

Implementation strategies:

  • Population replacement approaches: Releasing mosquitoes carrying Wolbachia with engineered plsY to establish stable infections that block pathogen transmission

  • Incompatible insect technique: Using plsY modifications to enhance cytoplasmic incompatibility for population suppression

  • Combination with other interventions: Synergizing with insecticides or other genetic control approaches

Research needs:

  • Comprehensive understanding of plsY structure-function relationships: Identifying specific modifications that enhance desired traits

  • Development of Wolbachia transformation systems: Currently challenging but necessary for precise plsY engineering

  • Field testing of modified strains: Evaluating effectiveness and safety under controlled conditions

The successful application of engineered plsY would build upon existing Wolbachia-based vector control programs, potentially expanding their effectiveness to additional vector species and disease systems beyond the current applications .

How might plsY inhibitors be developed as potential anti-Wolbachia therapeutics for filarial diseases?

Developing plsY inhibitors as anti-Wolbachia therapeutics for filarial diseases represents a promising approach, given that approximately 47% of the Onchocercidae family of filarial nematodes harbor Wolbachia endosymbionts . This strategy offers several advantages:

Target validation considerations:

  • Essential nature: As a critical enzyme in bacterial membrane phospholipid biosynthesis, plsY inhibition should significantly impact Wolbachia survival

  • Structural uniqueness: The bacterial plsY enzyme differs substantially from mammalian glycerol-3-phosphate acyltransferases , potentially allowing selective targeting

  • Established precedent: Anti-Wolbachia therapies already show promise for treating filarial diseases

Drug development pathway:

  • Structure-based design: Using the known topology and conserved motifs of plsY to design inhibitors targeting critical residues

  • High-throughput screening: Developing assays to test compound libraries against recombinant Wolbachia plsY

  • Known inhibitor optimization: Building upon the observation that palmitoyl-CoA noncompetitively inhibits plsY

Delivery considerations:

  • Multiple membrane barriers: Effective inhibitors must penetrate host cell membranes, filarial nematode tissues, and Wolbachia membranes

  • Extended treatment requirements: Current anti-Wolbachia treatments require 4-6 weeks of treatment

  • Formulation approaches: Nanoparticle or liposomal delivery systems might enhance targeting

Testing pipeline:

  • In vitro enzyme assays: Initial screening against purified recombinant plsY

  • Cell culture models: Testing in Wolbachia-infected insect cell lines

  • Ex vivo worm assays: Evaluating effects on Wolbachia within isolated filarial worms

  • Animal models: Testing in rodent models of filariasis

This approach could contribute to the development of novel anti-Wolbachia therapies that address the significant global health burden of filarial diseases.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.