Recombinant Wolbachia sp. subsp. Brugia malayi ATP synthase subunit a (atpB)

Shipped with Ice Packs
In Stock
Cat. No.
BT2140224
Source
in vitro E.coli expression system
Synonyms
atpB; Wbm0460; ATP synthase subunit a; ATP synthase F0 sector subunit a; F-ATPase subunit 6
Quick Inquiry

Description

Molecular and Functional Overview

Gene and Protein Identity

  • Gene: atpB (UniProt ID: Q5GSH6) .

  • Protein: ATP synthase subunit a (F₀ sector component), also termed F-ATPase subunit 6 .

  • Function: Forms part of the proton-translocating F₀ sector of ATP synthase, enabling proton transport across bacterial membranes to drive ATP synthesis .

Key Production Parameters

ParameterDetailsSource
ClonalityRecombinant (cloning details unspecified)
PurityNot explicitly stated; inferred from SDS-PAGE (common for recombinant proteins)
ConcentrationNot provided (typically optimized for downstream applications)
Expression SystemE. coli (standard for bacterial recombinant protein production)

Biological Significance

  • Wolbachia-Host Symbiosis: Wolbachia provides metabolic support to B. malayi, including nucleotide and riboflavin biosynthesis . ATP synthase subunits like atpB are critical for maintaining bacterial viability and host-parasite interactions.

  • Target for Drug Development: Disrupting Wolbachia ATP synthase could impair its energy metabolism, a potential strategy for filariasis treatment .

Experimental Utility

  • Immunological Studies: Recombinant atpB may serve as an antigen to study immune responses or develop diagnostic tools, though no direct studies are documented in available sources.

  • Structural Biology: The His-tagged protein enables crystallization or NMR studies to elucidate F₀ sector mechanisms .

  1. Functional Studies: No published data on ATP synthase activity or proton transport efficiency of recombinant atpB.

  2. Immunogenicity: Unlike Wolbachia RecA or wsp proteins , atpB’s immune reactivity in hosts is unexplored.

  3. Structural Dynamics: High-resolution structures of atpB could reveal insights into F₀ sector assembly.

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to sediment the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
atpB; Wbm0460; ATP synthase subunit a; ATP synthase F0 sector subunit a; F-ATPase subunit 6
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-241
Protein Length
full length protein
Species
Wolbachia sp. subsp. Brugia malayi (strain TRS)
Target Names
atpB
Target Protein Sequence
MALNPLEQFKIHTIVELPKLFGHDINFTNSSLFMMISVVSVILFLLLGVRKGAVIPGYLQ AAVEYVYDFITSIIESNTGSKGLKHIPLVFTVFTFTLSCNLVGMLPYSFTVTSHVIVTFA LSMIVFTYTTIVGFKEKGINFLRILLPEGIPSWLAPMMVFIKLFAYLARPISLSIRLAAN MIAGHTIIKVVAGFIMNMHLILTPIPFLFIIALIGFEVFVAILQAYIFTILTCIYLSDAV K
Uniprot No.
Q5GSH6

Target Background

Function
A key component of the proton channel, directly involved in proton translocation across the membrane.
Database Links

KEGG: wbm:Wbm0460

STRING: 292805.Wbm0460

Protein Families
ATPase A chain family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *

Category

Service

THE BIOTEK
THE BioTek is a global biotech company offering highly purified proteins for research in cancer, apoptosis, development, endocrinology, immunology, neuroscience, proteases, and stem cells.
  • Contact
  • Address: 1925 E Maple Ave, El Segundo, CA 90245 United States
  • Phone : +1 201-285-7826
  • Email : info@thebiotek.com
  • Hours : Mon.-Fri. 9:00 AM - 5:00 PM
© Copyright 2025 TheBiotek. All Rights Reserved.