Recombinant Wolbachia sp. subsp. Brugia malayi Glycerol-3-phosphate acyltransferase (plsY)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Wolbachia sp. subsp. Brugia malayi Glycerol-3-phosphate Acyltransferase (plsY)

The recombinant Wolbachia sp. subsp. Brugia malayi glycerol-3-phosphate acyltransferase (plsY) is a bioengineered protein derived from the plsY gene of Wolbachia, an obligate endosymbiont of the filarial nematode Brugia malayi. This enzyme plays a critical role in bacterial membrane phospholipid biosynthesis, catalyzing the transfer of acyl groups from acyl-phosphate to glycerol-3-phosphate (G3P), forming lysophosphatidic acid (LPA), a precursor for phosphatidic acid and other phospholipids .

Membrane Topology and Active Site Residues

PlsY is an integral membrane protein with five transmembrane domains, with the N-terminus and two short loops exposed externally . Key conserved motifs include:

  • Motif 1: Contains Ser and Arg residues essential for catalysis.

  • Motif 2: Glycine-rich region critical for G3P binding (mutating Gly to Ala increases Km for G3P) .

  • Motif 3: Features His and Asn residues for structural integrity and catalytic activity .

Enzymatic Function

PlsY operates in the PlsX-PlsY pathway, converting acyl-acyl carrier protein (ACP) to acyl-phosphate via PlsX, followed by acyl transfer to G3P . This pathway is vital for bacterial membrane synthesis and energy metabolism.

Symbiotic Significance

In Brugia malayi, Wolbachia endosymbionts provide essential nutrients (e.g., riboflavin, FAD) to the nematode, while the host supplies amino acids . The retention of plsY in Wolbachia genomes highlights its role in maintaining symbiotic interactions, potentially by supporting lipid synthesis for bacterial membrane integrity .

Experimental Use

Recombinant plsY is employed in in vitro assays to study:

  • Lipid biosynthesis: Elucidating phospholipid synthesis mechanisms .

  • Drug discovery: Screening for inhibitors targeting bacterial membrane pathways .

Inhibitory Insights

PlsY is noncompetitively inhibited by palmitoyl-CoA, suggesting a regulatory role in fatty acid metabolism .

Key Functional Motifs in PlsY

MotifSequence FeaturesRole in Catalysis
1Serine, Arginine residuesDirect catalytic activity
2Glycine-rich phosphate-binding loopG3P substrate recognition
3Histidine, Asparagine, GlutamateStructural stability and cofactor binding

Expression and Purification Parameters

ParameterDescription
HostE. coli
PurificationNi-NTA affinity chromatography (His-tag)
ReconstitutionDeionized sterile water (0.1–1.0 mg/mL)

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery timelines.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For short-term storage, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our standard glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is defined during production. If you have a specific tag preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
plsY; Wbm0423; Glycerol-3-phosphate acyltransferase; Acyl-PO4 G3P acyltransferase; Acyl-phosphate--glycerol-3-phosphate acyltransferase; G3P acyltransferase; GPAT; Lysophosphatidic acid synthase; LPA synthase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-191
Protein Length
full length protein
Species
Wolbachia sp. subsp. Brugia malayi (strain TRS)
Target Names
plsY
Target Protein Sequence
MEKYIVFVLSYILGSIPFSLVITKIKGINLREVGSGNIGATNVARTGSKCIAALALLLDS LKGFIAVYIAKQFFDDGSFHMYASAILVVLGHMFPVWLKFSGGKGVATTLGILIALNISL VLAFVFVWLAVFFAFRYSSLASLTSTIAAVLSSFFFQRDLFFTLLTVAILIFFKHYRNIV NLLQGRERKFS
Uniprot No.

Target Background

Function
Catalyzes the transfer of an acyl group from acyl-phosphate (acyl-PO(4)) to glycerol-3-phosphate (G3P), resulting in the formation of lysophosphatidic acid (LPA). This enzyme utilizes acyl-phosphate as the fatty acyl donor, but not acyl-CoA or acyl-ACP.
Database Links

KEGG: wbm:Wbm0423

STRING: 292805.Wbm0423

Protein Families
PlsY family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the biochemical function of Glycerol-3-phosphate acyltransferase (plsY) in Wolbachia?

Glycerol-3-phosphate acyltransferase (plsY) in Wolbachia functions as a key enzyme in phospholipid biosynthesis by catalyzing the acylation of glycerol-3-phosphate to form lysophosphatidic acid. Enzymatically, plsY transfers an acyl group from acyl-phosphate to the 1-position of glycerol-3-phosphate, representing the first committed step in bacterial membrane phospholipid formation via the acyl-phosphate pathway. This reaction can be represented as:

Acyl-phosphate + Glycerol-3-phosphate → 1-Acyl-glycerol-3-phosphate (Lysophosphatidic acid) + Pi

The enzyme is classified under EC 2.3.1.n3 and is alternatively known as Acyl-PO4 G3P acyltransferase, Acyl-phosphate--glycerol-3-phosphate acyltransferase, or G3P acyltransferase (GPAT) . In the context of Wolbachia as an endosymbiont, this enzyme likely plays a vital role in maintaining bacterial membrane integrity, which is essential for survival within the filarial host.

What storage and handling conditions are recommended for recombinant Wolbachia plsY?

For optimal stability and activity of recombinant Wolbachia plsY, the following storage and handling conditions are recommended:

  • Storage buffer: Tris-based buffer with 50% glycerol, specifically optimized for this protein

  • Primary storage temperature: -20°C

  • Extended storage: -20°C or -80°C

  • Working aliquots: Can be stored at 4°C for up to one week

  • Freeze-thaw cycles: Repeated freezing and thawing is not recommended

These conditions help maintain protein stability and enzymatic activity. The high glycerol concentration (50%) in the storage buffer prevents freeze-thaw damage and protein denaturation, while the optimized Tris-based buffer maintains proper pH conditions for stability. Researchers should prepare small working aliquots to avoid repeated freeze-thaw cycles that could compromise protein integrity.

How can researchers assess the enzymatic activity of recombinant Wolbachia plsY?

Assessing the enzymatic activity of recombinant Wolbachia plsY requires experimental setups that can measure the formation of lysophosphatidic acid from glycerol-3-phosphate and acyl-phosphate. Several methodological approaches can be employed:

Assay TypeMethodologyAdvantagesLimitations
Radiometric assayUse of [14C]-labeled glycerol-3-phosphate or acyl-phosphate as substrate, followed by extraction and quantification of labeled productHigh sensitivity; direct measurement of product formationRequires radioactive materials; specialized waste disposal
Coupled spectrophotometric assayLinking plsY activity to a secondary reaction that produces a spectrophotometric signalReal-time monitoring; non-radioactivePotential interference from coupling enzymes
LC-MS/MS analysisDirect detection and quantification of lysophosphatidic acid formationHigh specificity; can identify product variantsRequires sophisticated instrumentation
Colorimetric phosphate assayMeasurement of released inorganic phosphateSimple; inexpensiveIndirect measure; potential background from other phosphate sources

For optimal results, reaction conditions should be optimized for pH (typically 7.0-8.0), temperature (30-37°C), and appropriate cofactor concentrations. Control experiments should include heat-inactivated enzyme and reactions without acyl-phosphate to establish background levels.

What expression systems are most suitable for producing functional recombinant Wolbachia plsY?

The choice of expression system significantly impacts the yield and functionality of recombinant Wolbachia plsY. As a membrane-associated bacterial enzyme, special considerations are necessary:

Expression SystemMethodologyAdvantagesLimitations
E. coli with fusion tagsExpression with solubility-enhancing tags (MBP, SUMO) or membrane protein tagsHigh yield; easy genetic manipulation; cost-effectiveMay not achieve proper folding; potential toxicity
Baculovirus-insect cellExpression in insect cells (Sf9, Hi5)Better folding of complex proteins; suitable for membrane proteinsHigher cost; more complex protocols; lower yield
Cell-free expressionIn vitro translation with membrane mimeticsAvoids toxicity issues; rapid; allows toxic protein expressionLower yield; expensive; may require optimization
Yeast expression systemsExpression in P. pastoris or S. cerevisiaePost-translational modifications; good for membrane proteinsLonger development time; potential glycosylation differences

For recombinant Wolbachia plsY, an E. coli system with a membrane protein-specific tag might provide a good starting point, but researchers should be prepared to optimize conditions or switch to alternative systems if issues with folding or activity arise. The current commercial preparation appears to use a tag-based system, though the specific tag type is determined during the production process .

What techniques can be used to study the interaction between Wolbachia plsY and potential inhibitors?

Understanding the interaction between Wolbachia plsY and potential inhibitors is crucial for drug development efforts. Multiple complementary techniques can be employed:

  • Enzyme inhibition assays: Measuring plsY activity in the presence of various concentrations of potential inhibitors to determine IC50 values and inhibition kinetics (competitive, non-competitive, or uncompetitive).

  • Thermal shift assays: Monitoring changes in protein thermal stability upon inhibitor binding using differential scanning fluorimetry.

  • Surface plasmon resonance (SPR): Quantifying binding kinetics and affinity between immobilized plsY and inhibitors in real-time.

  • Isothermal titration calorimetry (ITC): Measuring thermodynamic parameters of inhibitor binding to determine binding enthalpy, entropy, and stoichiometry.

  • Computational modeling: Using homology models (if crystal structure is unavailable) to predict binding modes and perform virtual screening of compound libraries.

For membrane proteins like plsY, these techniques may require adaptation, such as the use of detergent micelles or nanodiscs to maintain protein stability in an aqueous environment while preserving native-like structure and function.

How does Wolbachia plsY contribute to the symbiotic relationship with Brugia malayi?

Wolbachia plsY likely plays a significant role in the symbiotic relationship with Brugia malayi through its function in bacterial membrane phospholipid biosynthesis. While the search results don't directly address plsY's specific contribution, several important connections can be made:

  • Wolbachia dependence: Wolbachia is essential for worm fertility, survival, and contributes to filarial disease pathogenesis . As a key enzyme in bacterial membrane synthesis, plsY is likely critical for Wolbachia survival within the nematode.

  • Developmental significance: During B. malayi L3 to L4 development, 57 Wolbachia proteins were detected , suggesting active bacterial metabolism during these critical developmental transitions. The phospholipids synthesized through the plsY pathway may support both bacterial replication and potentially contribute to host developmental processes.

  • Metabolic complementation: The retention of phospholipid biosynthesis pathways in the reduced Wolbachia genome suggests this metabolic function cannot be compensated by the host, pointing to potential metabolic dependencies in the symbiotic relationship.

  • Immune modulation: While not directly linked to plsY, other Wolbachia components like HSP60 have been shown to modulate the host immune response . The bacterial membrane, whose synthesis depends on plsY, contains immunomodulatory molecules that may influence host-parasite interactions.

What evidence exists for the expression of Wolbachia plsY during different life stages of Brugia malayi?

The developmental expression pattern of Wolbachia plsY across Brugia malayi life stages provides insight into its functional significance. Based on the proteomics study described in search result :

A comprehensive transcriptomic and proteomic analysis specifically examining plsY expression across all life stages would provide more definitive evidence. Current data suggests Wolbachia metabolism is active during key developmental transitions, but the specific contribution of plsY remains an area for further investigation.

How does Wolbachia lipid metabolism potentially interact with Brugia malayi developmental processes?

The interaction between Wolbachia lipid metabolism and Brugia malayi development represents a complex relationship that may involve multiple mechanisms:

  • Developmental coordination: The comprehensive proteomic study of B. malayi L3 to L4 development identified distinct protein expression phases, with developmental processes including "energy metabolism, immune evasion through secreted proteins, protein modification, and extracellular matrix-related processes involved in the development of new cuticle" . Wolbachia lipid metabolism may be coordinated with these host processes.

  • Cuticle formation: The development of new cuticle during molting requires significant membrane remodeling. Wolbachia-derived lipids could potentially contribute to this process, particularly during the middle and late phases of development when cuticle formation is active.

  • Energy provision: Phospholipid metabolism interfaces with energy metabolism pathways. Wolbachia may contribute to the energy requirements of developmental transitions through its metabolic activities.

  • Signaling functions: Lysophosphatidic acid, the product of plsY activity, can function as a signaling molecule in many biological systems. While speculative, Wolbachia-derived lipid metabolites could potentially act as signaling molecules influencing nematode development.

Further research using metabolic labeling approaches and comparative lipidomics could help elucidate the specific contributions of Wolbachia lipid metabolism to Brugia malayi development.

What methodological approaches can be used to validate plsY as a target for anti-filarial drug development?

Validating Wolbachia plsY as a drug target requires multiple complementary approaches:

  • Target essentiality validation:

    • Conditional gene silencing using inducible systems if genetic manipulation is possible

    • Depletion of enzyme using proteolysis-targeting chimeras (PROTACs) approaches

    • Correlation between degree of inhibition and Wolbachia survival/replication

  • Chemical validation:

    • Development of selective plsY inhibitors with different chemical scaffolds

    • Demonstration of on-target activity through resistance mutations or complementation studies

    • Correlation between biochemical inhibition and anti-Wolbachia/anti-filarial activity

  • In vitro efficacy assessment:

    • Testing inhibitors in Brugia malayi L3 to L4 in vitro molting system as described in

    • Evaluation of effects on Wolbachia load using qPCR

    • Examination of impact on worm viability and development

  • In vivo proof-of-concept:

    • Testing in animal models of filariasis

    • Demonstration of reduction in Wolbachia loads and consequent effects on worm viability

    • Comparison with established anti-Wolbachia antibiotics like doxycycline

  • Specificity assessment:

    • Profiling against human acyltransferases to establish selectivity window

    • Testing for activity against gut microbiome bacteria to assess potential side effects

These approaches collectively would establish whether inhibiting plsY is both effective in reducing Wolbachia and consequently affecting filarial nematode viability and development.

How can researchers differentiate between effects of plsY inhibition and general anti-Wolbachia effects?

Establishing causality between plsY inhibition specifically and observed anti-filarial effects requires carefully designed experiments:

  • Genetic complementation approaches:

    • Introduction of alternative phospholipid synthesis pathways into Wolbachia

    • Expression of plsY variants resistant to specific inhibitors

    • These approaches can determine whether observed effects are specifically due to plsY inhibition

  • Metabolic bypass experiments:

    • Supplementation with lysophosphatidic acid or downstream metabolites to determine if this rescues effects of plsY inhibition

    • This can establish whether the primary mechanism is indeed blockade of this specific metabolic pathway

  • Temporal analysis of effects:

    • Detailed time course studies examining:

      • Changes in phospholipid composition

      • Wolbachia membrane integrity

      • Wolbachia replication

      • Filarial nematode viability and development

    • This can establish the sequence of events following plsY inhibition

  • Comparative studies with other anti-Wolbachia agents:

    • Comparison with antibiotics like doxycycline that target protein synthesis

    • Comparison with other metabolic inhibitors targeting different pathways

    • This can identify effects specific to phospholipid synthesis inhibition versus general anti-Wolbachia effects

  • Proteomic and transcriptomic profiling:

    • Analysis of changes in Wolbachia and B. malayi protein/gene expression following plsY inhibition

    • Comparison with profiles from general antibiotics

    • This can identify pathway-specific signatures

These approaches would help distinguish between direct effects of plsY inhibition and secondary consequences of general Wolbachia depletion.

What challenges exist in developing selective inhibitors of Wolbachia plsY?

Developing selective inhibitors of Wolbachia plsY faces several significant challenges:

  • Structural challenges:

    • Limited structural information on Wolbachia plsY

    • Membrane protein nature complicates crystallography or cryo-EM studies

    • Challenges in expressing sufficient quantities of properly folded protein for structural studies

  • Selectivity issues:

    • Need to achieve selectivity over human glycerol-3-phosphate acyltransferases

    • Potential cross-reactivity with acyltransferases from beneficial microbiome bacteria

    • Need for selectivity over other acyltransferases to minimize off-target effects

  • Drug delivery challenges:

    • Multiple barriers to overcome:

      • Host tissue barriers

      • Nematode cuticle

      • Wolbachia cell membrane

    • Physicochemical properties needed for penetration may conflict with properties for enzyme inhibition

  • Target validation limitations:

    • Difficulty of genetic manipulation in Wolbachia

    • Challenge of establishing direct causality between plsY inhibition and anti-filarial effects

    • Limited tools for measuring target engagement in intact worms

  • Drug resistance considerations:

    • Potential for mutations in plsY conferring resistance

    • Possible compensatory mechanisms through alternative metabolic pathways

    • Need for resistance profiling in preclinical development

Addressing these challenges requires multidisciplinary approaches combining structural biology, medicinal chemistry, pharmacology, and parasitology.

How does the Wolbachia plsY pathway compare to analogous pathways in the Brugia malayi host?

Understanding the comparative biochemistry of phospholipid synthesis between Wolbachia and its nematode host provides insights into potential selectivity and the nature of their metabolic relationship:

  • Pathway differences:

    • Bacterial plsY utilizes acyl-phosphate as the acyl donor

    • Eukaryotic systems typically use acyl-CoA for similar reactions

    • These differences create potential for selective targeting

  • Evolutionary significance:

    • Retention of plsY in the reduced Wolbachia genome suggests this function cannot be provided by the host

    • Indicates possible metabolic complementation or specialization between endosymbiont and host

  • Metabolic integration:

    • Phospholipids or their precursors synthesized by Wolbachia may be utilized by the nematode host

    • This potential metabolic sharing may explain the dependence of Brugia malayi on Wolbachia

  • Comparative regulation:

    • Differential regulation of phospholipid synthesis between bacteria and eukaryotes

    • Potential coordinated regulation between host and endosymbiont during development

  • Comparative inhibitor sensitivity:

    • Structural differences between bacterial plsY and eukaryotic acyltransferases create opportunities for selective inhibition

    • Understanding these differences is crucial for rational inhibitor design

Detailed comparative biochemical and structural studies would further illuminate these differences and their implications for drug development.

What implications does Wolbachia plsY research have for understanding broader endosymbiont-host relationships?

Research on Wolbachia plsY extends beyond filarial disease treatment to illuminate fundamental aspects of endosymbiont-host relationships:

  • Metabolic co-evolution:

    • The retention and function of plsY in Wolbachia exemplifies how endosymbionts maintain certain metabolic pathways despite genome reduction

    • This provides insights into the principles governing metabolic complementation in endosymbiotic relationships

  • Therapeutic paradigms:

    • Targeting endosymbiont metabolism as an indirect approach to controlling the host organism establishes a paradigm applicable to other host-endosymbiont systems

    • Success with anti-Wolbachia approaches could inspire similar strategies for other diseases involving endosymbionts

  • Evolutionary insights:

    • The specifics of which metabolic pathways are retained versus lost in endosymbionts reveals the selective pressures shaping these relationships

    • Phospholipid metabolism retention suggests its fundamental importance in the symbiotic relationship

  • Host dependency mechanisms:

    • Understanding how filarial nematodes become dependent on Wolbachia-derived metabolites illuminates general principles of host-endosymbiont interdependence

    • This may apply to other symbiotic systems from insects to plants

  • Immunological aspects:

    • Wolbachia is implicated in immune modulation during filarial infection

    • Membrane components, whose synthesis depends on plsY, may play roles in this immune interaction

    • This illuminates how endosymbionts can modify host-pathogen immunological relationships

These broader implications position Wolbachia plsY research at the intersection of microbiology, parasitology, evolutionary biology, and immunology, with potential applications beyond filarial disease treatment.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.