Recombinant Woolly monkey hepatitis B virus Large envelope protein (S)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we currently have in stock. However, if you have specific requirements for the format, please indicate your needs when placing your order, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchase method or location. Please consult your local distributor for specific delivery estimates.
Note: All of our proteins are shipped with standard blue ice packs by default. If you require shipping with dry ice, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial prior to opening to ensure the contents settle to the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors including storage conditions, buffer components, temperature, and the protein's intrinsic stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type in mind, please inform us and we will prioritize development of the specified tag.
Synonyms
S; Large envelope protein; L glycoprotein; L-HBsAg; LHB; Large S protein; Large surface protein; Major surface antigen
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
2-391
Protein Length
Full Length of Mature Protein
Species
Woolly monkey hepatitis B virus (isolate Louisville) (WMHBV)
Target Names
S
Target Protein Sequence
GLNQSTFNPLGFFPSHQLDPLFKANAGSADWDKNPNKDPWPQAHDTAVGAFGPGLVPPHG GLLGWSSQAQGLSVTVPDTPPPPSTNRDKGRKPTPATPPLRDTHPQAMTWNTSSFQSYLQ NPKVRGLYFPAGGSTSSIVNPVPTTASTTSSSFSTTGVPVSTMDITSSGFLGPLLALQAV FFLLTKILTMPQSLDSLWTSLNFLGGTPACPGLNSQSPTSSHSPTCCPPTCPGYRWMCLR RSIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPTVTGTTTTTGPCRTCTPIVPGISSYPS CCCTKPTDGNCTCIPIPSSWAFAKFLWDWALARFSWLNSLLPFVQWFAGLSPTVWLLVIW MMWFWGPSLFSILSPFLPLLPLFFWLWAYI
Uniprot No.

Target Background

Function
The large envelope protein exists in two topological conformations: 'external' or Le-HBsAg and 'internal' or Li-HBsAg. In its external conformation, the protein binds to cell receptors, initiating infection. This interaction dictates species specificity and liver tropism. This binding triggers virion internalization predominantly through caveolin-mediated endocytosis. The large envelope protein also facilitates fusion between the virion membrane and endosomal membrane. In its internal conformation, the protein plays a role in virion morphogenesis and mediates contact with the nucleocapsid, acting like a matrix protein. The middle envelope protein plays a crucial role in the budding of the virion. It is involved in inducing budding in a nucleocapsid-independent manner. During this process, the majority of envelope proteins bud to form subviral lipoprotein particles of 22 nm in diameter that do not contain a nucleocapsid.
Database Links

KEGG: vg:26101581

Protein Families
Orthohepadnavirus major surface antigen family
Subcellular Location
Virion membrane.

Q&A

What is the Woolly Monkey Hepatitis B Virus Large Envelope Protein and why is it significant for research?

The Woolly Monkey Hepatitis B Virus (WMHBV) Large envelope protein (L) is one of three envelope proteins encoded by WMHBV, a member of the Orthohepadnavirus genus of the Hepadnaviridae family. The L protein contains three domains: the S domain (shared with all envelope proteins), the pre-S2 domain, and the pre-S1 domain. Its significance lies in:

  • WMHBV was the first hepadnavirus other than human HBV known to infect non-human primates

  • The L protein plays essential roles in viral assembly and host cell entry

  • It serves as a valuable model for understanding human HBV biology due to antigenic similarities

  • The pre-S1 region contains determinants for host range specificity that may elucidate mechanisms of cross-species transmission

How does the structure of WMHBV Large envelope protein compare to human HBV?

WMHBV L protein shares structural similarities with human HBV L protein but exhibits significant sequence divergence:

  • Both contain S, pre-S2, and pre-S1 domains arranged similarly

  • The pre-S1 domain shows the highest divergence (approximately 32%)

  • Both undergo similar post-translational modifications including myristoylation at Gly-2 of the pre-S1 domain

  • The pre-S1 domain overlaps with the spacer domain of the viral polymerase, allowing sequence divergence while maintaining polymerase function

FeatureHuman HBV L ProteinWMHBV L Protein
Number of amino acids389-400 (varies by genotype)391 (as reported in reference)
DomainsS, pre-S2, pre-S1S, pre-S2, pre-S1
Pre-S1 sequence divergenceReference~32% divergence from human HBV
Key modificationsMyristoylation at Gly-2, phosphorylation at various sitesSimilar pattern of modifications

What expression systems are used to produce recombinant WMHBV Large envelope protein for research?

Several expression systems have been successfully used to produce recombinant WMHBV L protein:

  • E. coli expression systems: Commonly used with His-tagging for purification, though may lack proper post-translational modifications

  • Mammalian cell expression: Human hepatoma cell lines (HuH-7, HepG2) transfected with plasmids containing the WMHBV pre-S1-pre-S2-S gene

  • Cell-free expression systems: Wheat germ extracts have been used for HBV L protein and could be applied to WMHBV

Recommended methodology for mammalian expression:

  • Clone the WMHBV pre-S1-pre-S2-S gene into an appropriate expression vector (e.g., pZErO-1)

  • Transfect human hepatoma cells using appropriate transfection reagents (e.g., JetPEI™)

  • Verify expression through Western blotting using antibodies against the pre-S1 domain or epitope tags

How can researchers accurately map the phosphorylation sites in WMHBV Large envelope protein and what is their functional significance?

Phosphorylation mapping of WMHBV L protein requires combinatorial approaches:

Methodological Approach:

  • Multiple expression systems comparison: Use both in vitro cell-free synthesis and in vivo expression with co-expression of relevant kinases

  • Mass spectrometry techniques: Employ both LC-MS/MS and MALDI-TOF analyses on protein fragments and full-length protein

  • Complementary verification by NMR: For unambiguous identification of phosphorylation sites

Based on HBV studies, key phosphorylation sites likely include equivalents to S6, T57, S67, T95, S98, and S148 in the human HBV L protein . While phosphorylation of L protein in avian hepadnaviruses appears dispensable for infectivity, specific modifications in WMHBV L protein might:

  • Regulate interactions with the viral capsid during assembly

  • Modulate binding to cellular receptors

  • Affect membrane association and envelope protein topology

Researchers should compare phosphorylated versus non-phosphorylated variants in functional assays to determine site-specific roles in the viral life cycle .

How do researchers experimentally determine the role of specific residues in the WMHBV pre-S1 domain in host range restriction?

The pre-S1 domain contains critical determinants for host range specificity. To experimentally determine the role of specific residues:

Methodological Approach:

  • Construction of chimeric envelope proteins: Create constructs swapping segments of the pre-S1 domain between WMHBV and HBV using overlapping PCR and molecular cloning

  • Hepatitis Delta Virus (HDV) pseudotyping assay: Generate recombinant HDV particles pseudotyped with wild-type or chimeric envelope proteins

  • Infection of primary hepatocytes: Test infectivity on primary hepatocytes from different species (human, spider monkey, squirrel monkey)

  • Neutralization assays: Use synthetic pre-S1 peptides or antibodies to block infection and map interaction domains

Key findings from previous research:

  • A short 9-amino acid region within the first 30 residues of the pre-S1 domain is critical for host range determination

  • Adding human HBV amino terminus to WMHBV L protein unexpectedly increased infectivity for spider monkey hepatocytes but not human hepatocytes

  • The L protein likely contains two domains affecting infectivity, with sequences downstream of residue 40 also influencing host range

What experimental systems effectively model WMHBV Large envelope protein interactions with the viral capsid during virion morphogenesis?

To study L protein-capsid interactions during virion assembly:

Methodological Approaches:

  • Co-expression systems: Transfect cells with vectors expressing WMHBV core protein and L protein (with or without fluorescent tags)

  • FRET analysis: Use Fluorescence Resonance Energy Transfer to detect protein-protein interactions in living cells with fluorescently tagged proteins

  • Transmission Electron Microscopy (TEM): Employ both regular TEM and immuno-TEM (Tokuyasu method) to visualize capsid-L protein complexes at nanometric resolution

  • Immunoprecipitation: Perform co-IP assays to biochemically confirm interactions between L protein and assembled capsids

Notable observations from HBV studies applicable to WMHBV research:

  • Capsids remain individually dispersed in the absence of L protein but cluster in its presence

  • The matrix domain of L protein is essential for capsid recruitment

  • Interaction occurs at membrane-rich regions peripheral to the nucleus, associated with late endosomes/multivesicular bodies

  • Assembled capsids, rather than individual core proteins, interact with L protein

How can researchers develop and validate squirrel monkey models for WMHBV infection to test antivirals against HBV-related viruses?

Squirrel monkeys represent a promising animal model for WMHBV infection. To develop and validate this model:

Methodological Framework:

  • NTCP receptor characterization: Compare the sodium taurocholate co-transporting polypeptide (NTCP) sequence across species, focusing on residues 157-165 and 84-87 that determine HBV/WMHBV binding

  • PreS1 peptide binding assays: Test binding of myristoylated PreS1 peptides to squirrel monkey NTCP expressed in cell lines

  • In vitro infection systems: Isolate primary squirrel monkey hepatocytes (SMHs) and test susceptibility to WMHBV infection

  • In vivo infection protocols: Optimize routes of inoculation, viral dose, and monitoring protocols

ParameterExperimental DetailsKey Findings
Viral inoculumWMHBV, AAV-WMHBVAAV-WMHBV yields higher viremia (10^8 genomes/mL)
Infection durationAdult: up to 8 months; Neonate: up to 6 monthsLonger viremia than other non-human primate models
Detection methodsTaqMan PCR and RT-PCR assaysDifferent primer sets for DNA and RNA quantification
Evidence of replicationcccDNA detection in liverConfirms complete replication cycle

This model's value lies in the extended viremia period (6-8 months), which is longer than in other non-human primate models, making it suitable for testing antiviral therapies against hepadnaviruses .

What methodological approaches most effectively characterize the role of WMHBV Large envelope protein phosphorylation in cross-species transmission?

Investigating phosphorylation in cross-species transmission requires integrated approaches:

Comprehensive Methodology:

  • Comparative phosphoproteomics: Analyze phosphorylation patterns of L proteins from different hepadnaviruses (HBV, WMHBV, CMHBV) using mass spectrometry

  • Site-directed mutagenesis: Generate phospho-mimetic (S/T→D/E) and phospho-deficient (S/T→A) mutants of predicted phosphorylation sites

  • Cross-species binding assays: Test binding of wild-type and mutant L proteins to NTCP from different primate species

  • Structural biology approaches: Use NMR or cryo-EM to determine how phosphorylation affects L protein conformation and interaction with receptors

Research on HBV L protein has identified phosphorylation sites at strategic locations potentially involved in receptor binding and virus-host interactions . For WMHBV, focus on:

  • Comparing phosphorylation patterns between WMHBV isolates that infect different primate species

  • Determining if phosphorylation status affects binding efficiency to NTCP variants

  • Investigating whether post-entry events are influenced by the phosphorylation state of viral envelope proteins

How do researchers identify and characterize recombination events between WMHBV and other hepadnaviruses, and what implications do these events have for viral evolution?

Recombination is a significant driver of hepadnavirus evolution. To identify and characterize recombination events:

Methodological Framework:

  • Large-scale sequence retrieval: Collect complete genome sequences of hepadnaviruses including WMHBV and related viruses

  • Automated phylogenetic analysis: Employ TreeOrder scanning and related computational methods to detect potential recombinants

  • Breakpoint mapping: Identify recombination hotspots and precise breakpoint positions

  • Functional validation: Test whether recombinant envelope proteins retain functionality in viral entry and assembly

For WMHBV envelope protein research:

  • Focus on the pre-S1 domain as a potential recombination hotspot due to its role in host specificity

  • Consider that recombination between WMHBV and human HBV genotypes (particularly F and H) may have evolutionary significance, as these share a phylogenetic sister-relationship

  • Evaluate recombinant envelope proteins for altered host range, immunogenicity, or assembly properties

This approach may provide insights into the evolutionary history of hepadnaviruses and the role of recombination in cross-species transmission events .

What are the optimal methods for producing and purifying WMHBV Large envelope protein with intact pre-S1 domain for structural studies?

Producing WMHBV L protein with an intact, properly folded pre-S1 domain requires specialized approaches:

Optimized Production Protocol:

  • Expression system selection: Mammalian expression systems (e.g., HEK293 or CHO cells) preserve post-translational modifications better than bacterial systems

  • Construct design: Include a cleavable N-terminal tag (e.g., His tag) positioned to minimize interference with pre-S1 function

  • Detergent screening: Test multiple detergents (DDM, LMNG, CHAPS) to maintain protein stability during extraction from membranes

  • Purification strategy: Employ a multi-step approach:

    • IMAC (immobilized metal affinity chromatography) using His-tag

    • Size exclusion chromatography

    • Ion exchange chromatography as needed

  • Quality control: Verify intact pre-S1 domain using Western blotting with domain-specific antibodies and mass spectrometry

Storage conditions are critical - maintain in Tris/PBS-based buffer with 6% trehalose at pH 8.0, and consider adding 5-50% glycerol for long-term storage at -20°C/-80°C .

How can researchers effectively employ WMHBV L protein chimeras to develop pan-hepadnaviral entry inhibitors?

The development of pan-hepadnaviral entry inhibitors using WMHBV L protein chimeras involves:

Strategic Research Approach:

  • Identification of conserved regions: Align pre-S1 sequences from multiple hepadnaviruses to identify conserved motifs critical for NTCP binding

  • Design of chimeric pre-S1 peptides: Create synthetic peptides containing conserved regions from both human HBV and WMHBV L proteins

  • Binding affinity determination: Measure binding to NTCP from different species using surface plasmon resonance or cellular binding assays

  • Cross-inhibition testing: Evaluate whether chimeric peptides can inhibit infection by both HBV and WMHBV in respective host cells

Research findings indicate that:

  • The first 30-40 amino acids of the pre-S1 domain are critical for receptor recognition

  • Specific 9-amino acid stretches within this region determine host specificity

  • Chimeric peptides containing key residues from both viruses might exhibit broader inhibitory activity

  • Myristoylation remains essential for the inhibitory activity of these peptides

Such pan-hepadnaviral inhibitors could provide valuable tools for studying virus-receptor interactions and potential therapeutic leads.

What methodological approaches can distinguish between assembly defects and entry defects when studying WMHBV L protein mutations?

Differentiating between assembly and entry defects in WMHBV L protein mutants requires specific experimental strategies:

Comprehensive Methodology:

  • Assembly assessment:

    • Quantify secreted viral particles by ELISA or native agarose gel electrophoresis

    • Examine particle morphology by electron microscopy

    • Assess incorporation of viral DNA by real-time PCR

    • Visualize L protein-core protein interactions using FRET and immuno-TEM

  • Entry evaluation:

    • Develop receptor binding assays using purified NTCP or NTCP-expressing cells

    • Perform infection studies with normalized particle numbers

    • Use HDV pseudotyping to isolate entry from other life cycle steps

    • Develop cell-cell fusion assays to evaluate fusion activity separately from binding

  • Distinguishing factors:

    • Assembly defects: Reduced particle secretion despite normal protein expression

    • Entry defects: Normal particle production but reduced infectivity

    • Combined defects: Both reduced secretion and impaired specific infectivity

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.