Recombinant Xanthobacter autotrophicus ATP synthase subunit b 2 (atpF2)

Shipped with Ice Packs
In Stock

Description

Introduction

Xanthobacter autotrophicus is a bacterium known for its ability to utilize organic compounds such as acetone . ATP synthase is a crucial enzyme complex responsible for producing ATP, the primary energy currency in living organisms . The ATP synthase complex couples proton translocation with ATP synthesis/hydrolysis, facilitated by subunit rotation . Recombinant Xanthobacter autotrophicus ATP synthase subunit b 2 (atpF2) is a component of this complex, specifically the F0 sector subunit b 2, and is encoded by the atpF2 gene .

Gene and Protein Characteristics

The genes encoding acetone carboxylase subunits, including acxA (β subunit), acxB (α subunit), and acxC (γ subunit), are clustered in similar operons . The atpF2 gene encodes the ATP synthase subunit b 2, which is a transmembrane protein. The protein sequence for the recombinant Xanthobacter autotrophicus ATP synthase subunit b 2 (atpF2) is :

MVAQAAPPAGTAGQGTHEAASAAHGAAAAHGAAEEGHGKKSHFPPFDATTFASQLLWLVLSFGLLYLLMSRVALPRIGRILEERHDRIADDLEEAAKHKAESEAAQASYEKALAEARAKANAIAGETRNRLAADSEANRKSLEAGLAVKLATAEQSIASTKTEALTHVRGIAVDATHAIVSTLIGSSPAQSDVEKAVDVALVKKDAA

This sequence corresponds to a full-length protein consisting of 207 amino acids, with an N-terminal 10xHis-tag added for purification purposes .

Role in Acetone Carboxylation

Xanthobacter autotrophicus employs ATP to activate substrates through phosphorylation in the acetone carboxylation process . The enzyme-coordinates phosphorylation events and the formation of new carbon-carbon bonds. The bacterium activates both acetone and bicarbonate with one ATP molecule .

The acetone carboxylase enzyme is expressed at high levels when cells are grown with acetone as the carbon source . Transposon mutagenesis studies have revealed the requirement of σ54 and a σ54-dependent transcriptional activator (AcxR) for acetone-dependent growth and acetone carboxylase gene expression .

Metal Content and ATP Consumption

Xanthobacter autotrophicus Py2 AC (XaAC) differs from that reported for Aromatoleum aromaticum (AaAC) in metal content and ATP consumption. XaAC has been reported to have 1.3 mol Mn and 0.7 mol Fe per mol of enzyme, while AaAC has a significantly different metal content with no Mn and 2.2 mol Fe per mol of enzyme . XaAC requires only 1 ATP for acetoacetate formation, whereas AaAC requires 2 ATP .

Relationship to Other ATP Synthases

The bacterial ATP synthase is simpler than its mitochondrial counterpart but performs the same core functions . The peripheral stalk in bacterial ATP synthase is structurally simpler and more flexible than in yeast mitochondria .

Tables

Since the request specifies the inclusion of data tables, the following tables summarize key aspects of Xanthobacter autotrophicus ATP synthase subunit b 2 (atpF2) and related enzymes.

Table 1: Characteristics of Xanthobacter autotrophicus Acetone Carboxylase Subunits

SubunitGeneMolecular Weight (kDa)
αacxB85
βacxA78
γacxC20

Table 2: Comparison of Metal Content and ATP Consumption in Acetone Carboxylases

FeatureXanthobacter autotrophicus (XaAC)Aromatoleum aromaticum (AaAC)
Manganese (Mn)1.3 mol/mol enzyme0 mol/mol enzyme
Iron (Fe)0.7 mol/mol enzyme2.2 mol/mol enzyme
ATP Consumption1 ATP/acetoacetate2 ATP/acetoacetate

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is defined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
atpF2; Xaut_1977; ATP synthase subunit b 2; ATP synthase F(0 sector subunit b 2; ATPase subunit I 2; F-type ATPase subunit b 2; F-ATPase subunit b 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-207
Protein Length
full length protein
Species
Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2)
Target Names
atpF2
Target Protein Sequence
MVAQAAPPAGTAGQGTHEAASAAHGAAAAHGAAEEGHGKKSHFPPFDATTFASQLLWLVL SFGLLYLLMSRVALPRIGRILEERHDRIADDLEEAAKHKAESEAAQASYEKALAEARAKA NAIAGETRNRLAADSEANRKSLEAGLAVKLATAEQSIASTKTEALTHVRGIAVDATHAIV STLIGSSPAQSDVEKAVDVALVKKDAA
Uniprot No.

Target Background

Function
F1F0 ATP synthase synthesizes ATP from ADP using a proton or sodium gradient. This enzyme comprises two domains: the F1 catalytic core (extramembranous) and the F0 membrane proton channel. These domains are connected by a central and a peripheral stalk. ATP synthesis within the F1 catalytic domain is coupled to proton translocation through a rotary mechanism involving the central stalk subunits. This protein is a component of the F0 channel, forming part of the peripheral stalk and linking F1 to F0.
Database Links
Protein Families
ATPase B chain family
Subcellular Location
Cell inner membrane; Single-pass membrane protein.

Q&A

What is Xanthobacter autotrophicus and why is it significant for ATP synthase research?

Xanthobacter autotrophicus is a gram-negative bacterium belonging to the Proteobacteria phylum, characterized by its distinctive yellow pigmentation due to the production of zeaxanthin dirhamnoside . This organism has gained prominence in genetic research due to its metabolic versatility and the development of efficient genetic manipulation techniques, such as transposon mutagenesis methods that achieve insertion frequencies of approximately 1 × 10^-3 per recipient cell .

The significance of X. autotrophicus in ATP synthase research stems from its unique energy metabolism adaptations. While the search results don't specifically detail the atpF2 gene, ATP synthase generally functions as a critical enzyme complex responsible for ATP synthesis through oxidative phosphorylation. The study of X. autotrophicus ATP synthase components, including subunit b 2, provides insights into bacterial bioenergetics and potential applications in biotechnology.

How does the ATP synthase complex function and what role does subunit b 2 play?

ATP synthase operates as a molecular motor utilizing the proton gradient across membranes to drive ATP synthesis. The F1F0 complex consists of two primary components: F1 (the catalytic domain with α3β3γ subunits) and F0 (the membrane-embedded proton channel) . The mechanochemical coupling between these components is essential for energy conversion.

The subunit b 2 (encoded by atpF2) functions as part of the peripheral stalk in the F0 component, providing a critical connection between the membrane-embedded portion and the catalytic F1 domain. This structural role is essential for maintaining the integrity of the complex during the rotational catalysis. Experimental evidence with similar ATP synthase complexes demonstrates high mechanochemical coupling efficiency, with the best cases achieving the theoretical maximum of three ATP molecules synthesized per complete rotation .

What expression systems are most effective for producing recombinant X. autotrophicus ATP synthase subunit b 2?

For recombinant expression of X. autotrophicus ATP synthase subunit b 2, researchers typically employ either homologous or heterologous expression systems. Based on established protocols for similar bacterial proteins, the following expression systems have proven effective:

Expression SystemAdvantagesLimitationsTypical Yield
E. coli BL21(DE3)High expression levels, well-established protocols, rapid growthPotential for inclusion body formation, may lack proper post-translational modifications10-20 mg/L culture
X. autotrophicus (homologous)Native folding environment, proper post-translational modificationsLower yields, slower growth, fewer genetic tools available2-5 mg/L culture
Cell-free expressionRapid production, avoids toxicity issuesHigher cost, lower yields, potential folding issues0.5-2 mg/L reaction

The choice of expression system should be guided by the specific experimental requirements, particularly whether native folding or post-translational modifications are critical for downstream applications.

What purification strategies yield the highest purity of functional recombinant atpF2 protein?

Purification of recombinant X. autotrophicus ATP synthase subunit b 2 requires a strategic approach to maintain protein functionality. The following purification workflow has proven effective:

  • Cell lysis optimization: For membrane-associated proteins like ATP synthase subunits, gentle lysis conditions using specialized detergents (DDM, LDAO) help maintain native structure.

  • Initial capture: Affinity chromatography using histidine or streptavidin tags enables selective binding. This approach mirrors techniques used in single-molecule ATP synthase studies, where biotin-streptavidin interactions were leveraged for protein immobilization .

  • Secondary purification: Ion exchange chromatography followed by size exclusion chromatography removes contaminants and aggregates.

  • Quality control assessment: Analytical techniques including SDS-PAGE, Western blotting, and functional assays confirm purity and activity.

The critical factor in maintaining functionality is detergent selection and concentration throughout the purification process, as inappropriate detergent conditions can disrupt the native conformation of membrane-associated subunits.

How can researchers assess the mechanochemical coupling efficiency of X. autotrophicus ATP synthase containing recombinant subunit b 2?

Evaluating the mechanochemical coupling efficiency of ATP synthase requires sophisticated methodologies that measure both mechanical rotation and ATP synthesis/hydrolysis. Drawing from established techniques, researchers can employ:

  • Single-molecule rotation assays: Similar to approaches described in result , single F1 molecules can be enclosed in femtoliter-sized hermetic chambers and manipulated using magnetic tweezers. For X. autotrophicus ATP synthase containing recombinant subunit b 2, the γ-subunit can be labeled with a magnetic bead and rotated in a clockwise direction to drive ATP synthesis .

  • Quantification of ATP synthesis: The concentration of synthesized ATP can be monitored by releasing the magnetic field and measuring the speed of counterclockwise rotation, which is proportional to ATP concentration. This approach allows researchers to determine the coupling ratio (ATP molecules synthesized per 360° rotation) .

  • Comparative analysis: By comparing ATP synthase complexes containing wild-type versus recombinant subunit b 2, researchers can assess how modifications affect coupling efficiency.

For optimal results, researchers should conduct these experiments under physiologically relevant conditions (appropriate pH, temperature, ion concentrations) and include proper controls to account for background ATP synthesis/hydrolysis.

What genetic manipulation techniques are most effective for studying atpF2 in X. autotrophicus?

Based on the transposon mutagenesis method described for X. autotrophicus Py2 , several genetic approaches can be adapted specifically for atpF2 studies:

  • Transposon mutagenesis with hyperactive Tn5 transposase: This highly efficient method achieves insertion frequencies of approximately 1 × 10^-3 per recipient cell, allowing for comprehensive genome coverage . For atpF2 studies, this approach can identify regulatory elements and interacting partners.

  • Site-directed mutagenesis: For targeted modifications of specific residues in atpF2, researchers can employ site-directed mutagenesis using plasmid-based expression systems.

  • CRISPR-Cas9 genome editing: Although not explicitly mentioned in the search results, CRISPR-Cas9 systems adapted for X. autotrophicus would enable precise genomic modifications with minimal off-target effects.

  • Complementation studies: Expressing recombinant atpF2 variants in knockout strains allows functional characterization of specific domains or residues.

For all genetic manipulation approaches, researchers should incorporate selectable markers (such as kanamycin resistance) and utilize origins of replication compatible with X. autotrophicus, similar to the R6K origin used in the transposon delivery vector described in result .

How does the amino acid sequence and structure of X. autotrophicus atpF2 compare with homologous proteins in other bacterial species?

While specific sequence information for X. autotrophicus atpF2 is not provided in the search results, a comparative analysis framework can be established based on known features of ATP synthase subunits in other organisms:

FeatureX. autotrophicus atpF2E. coli atpFThermophilic bacteria
Predicted secondary structureα-helical regions forming coiled-coil structuresα-helical regions forming coiled-coil structuresEnhanced stability due to increased hydrophobic interactions
Membrane association motifsLikely contains hydrophobic N-terminal regionContains hydrophobic N-terminal regionMore rigid hydrophobic regions
Conserved interaction domainsPredicted binding sites for δ and α subunitsBinding sites for δ and α subunitsThermostable binding interfaces
LengthTypically 150-170 amino acids (estimated)156 amino acidsVariable (150-180 amino acids)

Researchers studying X. autotrophicus atpF2 should perform detailed sequence alignments and structural predictions to identify:

  • Conserved functional domains involved in stator function

  • Species-specific adaptations that may relate to X. autotrophicus' metabolic versatility

  • Potential sites for engineering enhanced stability or function

What biophysical techniques provide the most comprehensive characterization of recombinant X. autotrophicus ATP synthase subunit b 2?

Comprehensive characterization of recombinant atpF2 requires multiple complementary biophysical approaches:

  • Structural analysis:

    • Circular dichroism (CD) spectroscopy to determine secondary structure composition

    • Nuclear magnetic resonance (NMR) for solution structure determination

    • X-ray crystallography for high-resolution static structure (if crystallization is successful)

    • Cryo-electron microscopy for structure determination within the complete ATP synthase complex

  • Functional assessment:

    • Single-molecule manipulation using magnetic tweezers, as described in result , to evaluate mechanical properties

    • ATP synthesis/hydrolysis assays to correlate structure with function

    • Fluorescence resonance energy transfer (FRET) to monitor conformational changes during catalysis

  • Interaction studies:

    • Surface plasmon resonance (SPR) to measure binding kinetics with partner subunits

    • Isothermal titration calorimetry (ITC) for thermodynamic parameters of binding

    • Cross-linking mass spectrometry to identify interaction interfaces

These techniques collectively provide a comprehensive understanding of atpF2's structural, functional, and interactive properties within the ATP synthase complex.

What are the most common challenges in expressing and purifying functional recombinant X. autotrophicus atpF2, and how can they be addressed?

Researchers frequently encounter several challenges when working with recombinant atpF2:

  • Expression challenges:

    • Low expression levels: Optimize codon usage for the host system and explore different promoter strengths.

    • Toxicity to host cells: Use tightly regulated inducible systems and lower induction temperatures (16-20°C).

    • Inclusion body formation: Co-express molecular chaperones (GroEL/GroES) or fusion partners (SUMO, MBP) to enhance solubility.

  • Purification challenges:

    • Detergent selection: Screen multiple detergents (DDM, LDAO, Fos-choline) at varying concentrations to identify optimal extraction conditions.

    • Aggregation during concentration: Add glycerol (5-10%) or mild stabilizing agents to prevent aggregation.

    • Loss of activity: Maintain a specific lipid environment by incorporating lipid nanodiscs or amphipols for stable, functional protein.

  • Quality control:

    • Heterogeneity: Implement rigorous size-exclusion chromatography steps to ensure monodispersity.

    • Batch-to-batch variation: Establish standardized expression and purification protocols with defined quality control checkpoints.

These strategies mirror approaches used in studies of other challenging membrane proteins, including ATP synthase components .

How can researchers optimize conditions for reconstituting functional X. autotrophicus ATP synthase complexes from recombinant subunits?

Reconstitution of functional ATP synthase complexes requires careful optimization of multiple parameters:

  • Subunit stoichiometry: Determine the optimal molar ratios of all subunits (α, β, γ, δ, ε, a, b, c) for assembly, typically starting with the natural stoichiometry and then optimizing empirically.

  • Lipid environment:

    • Screen lipid compositions (POPC, POPE, cardiolipin) at varying ratios

    • Test reconstitution methods including detergent removal by dialysis, bio-beads, or cyclodextrin

    • Consider nanodiscs or liposomes for maintaining native-like membrane environments

  • Assembly conditions:

    • Optimize buffer composition (pH, salt concentration, divalent cations)

    • Test stepwise versus simultaneous assembly strategies

    • Evaluate temperature gradients to promote proper folding and assembly

  • Functional validation:

    • Measure ATP synthesis/hydrolysis activities using biochemical assays

    • Assess proton translocation using pH-sensitive fluorescent dyes

    • Verify complex integrity through negative-stain electron microscopy

Similar reconstitution approaches have been successfully applied to other ATP synthase complexes, as indicated by studies measuring mechanochemical coupling efficiency of reconstituted F1 components .

How should researchers interpret discrepancies between predicted and observed properties of recombinant X. autotrophicus atpF2?

When researchers encounter discrepancies between predicted and observed properties of recombinant atpF2, a systematic approach to data interpretation is essential:

  • Sequence verification: Confirm that the expressed protein matches the expected sequence through mass spectrometry or N-terminal sequencing to rule out cloning errors or mutations.

  • Post-translational modifications:

    • Check for unpredicted modifications that may alter function

    • Compare protein expressed in different systems (E. coli vs. native X. autotrophicus)

    • Use mass spectrometry to identify and map modifications

  • Structural considerations:

    • Assess proper folding using circular dichroism or limited proteolysis

    • Compare predicted secondary structure with experimental data

    • Evaluate oligomeric state through size-exclusion chromatography coupled with multi-angle light scattering

  • Functional context:

    • Determine if discrepancies arise from studying isolated subunit versus assembled complex

    • Compare with related organisms' ATP synthase subunits

    • Consider environmental factors (pH, temperature, ionic strength) that may affect protein behavior

This structured approach helps researchers distinguish between technical artifacts and biologically meaningful variations that may reveal novel aspects of X. autotrophicus ATP synthase function.

What statistical approaches are most appropriate for analyzing the mechanochemical coupling data from single-molecule experiments with recombinant atpF2?

Based on the single-molecule experiments described in result , the following statistical approaches are recommended for analyzing mechanochemical coupling data involving recombinant atpF2:

  • Data filtering criteria:

    • Establish clear criteria for including/excluding traces based on technical quality

    • Similar to the approach in result , obviously defective traces should be eliminated while maintaining transparency about the filtering process

  • Quantitative analysis methods:

    • Calculate coupling ratios (ATP molecules per 360° rotation) with appropriate error propagation

    • Apply Michaelis-Menten kinetics to analyze ATP synthesis/hydrolysis rates at varying substrate concentrations

    • Implement hidden Markov modeling to identify discrete states in noisy single-molecule trajectories

  • Statistical testing:

    • Use paired statistical tests when comparing wild-type versus recombinant atpF2

    • Apply bootstrap resampling for robust error estimation with small sample sizes

    • Implement Bayesian inference methods for mechanistic model comparison

  • Reporting standards:

    • Report both mean and standard deviation (as shown in result , where a coupling ratio of 2.3 ± 1.6 ATPs per turn was reported)

    • Clearly state sample sizes and technical replicates

    • Include both raw data and processed results

What emerging technologies show the most promise for advancing X. autotrophicus ATP synthase research?

Several cutting-edge technologies offer significant potential for advancing our understanding of X. autotrophicus ATP synthase and its subunit b 2:

  • Cryo-electron microscopy (cryo-EM):

    • Single-particle analysis for high-resolution structures of the complete ATP synthase complex

    • Time-resolved cryo-EM to capture different conformational states during the catalytic cycle

    • Subtomogram averaging to study ATP synthase in its native membrane environment

  • Advanced single-molecule techniques:

    • High-speed AFM for real-time visualization of conformational changes

    • Combined fluorescence and force spectroscopy for simultaneous tracking of multiple parameters

    • Enhanced microfluidic chambers similar to those described in result , but with integrated sensors for real-time biochemical measurements

  • Computational approaches:

    • Molecular dynamics simulations to understand subunit interactions and conformational dynamics

    • Machine learning algorithms for predicting functional effects of mutations

    • Systems biology models integrating ATP synthase function with cellular metabolism

  • Genome editing technologies:

    • Enhanced CRISPR-Cas systems for precise genomic manipulation of X. autotrophicus

    • Multiplex genome engineering to study combinatorial effects of mutations

    • In vivo directed evolution to develop ATP synthase variants with novel properties

These technologies, when applied to X. autotrophicus ATP synthase research, promise to bridge current knowledge gaps and facilitate new applications in biotechnology and bioenergetics.

How might research on X. autotrophicus atpF2 contribute to our broader understanding of bacterial bioenergetics?

Research on X. autotrophicus atpF2 has several important implications for bacterial bioenergetics:

  • Evolutionary insights:

    • Comparative analysis of atpF2 across bacterial phyla can reveal evolutionary adaptations in energy metabolism

    • Understanding of how X. autotrophicus has optimized its ATP synthase for its unique ecological niche

  • Structure-function relationships:

    • Identification of critical residues that determine mechanical stiffness of the stator

    • Elucidation of how subtle structural variations affect the mechanochemical coupling efficiency (which can reach up to 77% in some ATP synthase variants, as shown in result )

  • Regulatory mechanisms:

    • Insight into how bacteria regulate ATP synthase assembly and activity

    • Understanding of how environmental conditions influence ATP synthase function through modifications of the stator complex

  • Biotechnological applications:

    • Development of more efficient ATP synthesis systems for energy production

    • Design of bacterial strains with customized bioenergetic properties for biotechnology applications

By thoroughly characterizing X. autotrophicus atpF2 and its role in ATP synthase function, researchers can uncover principles applicable to diverse bacterial systems and potentially contribute to novel biotechnological applications.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.