Recombinant Xanthobacter autotrophicus Cobalamin synthase (cobS)

Shipped with Ice Packs
In Stock

Description

Genetic Tools for CobS Expression in X. autotrophicus

Recent advancements in genetic engineering have enabled the development of modular toolkits like XanthoMoClo, which supports plasmid assembly, promoter selection, and terminator optimization in Xanthobacter species . Key components relevant to CobS expression include:

Table 1: Genetic Toolkit Components for Recombinant Protein Expression

ComponentFunctionExample PartsPerformance Metrics
Constitutive PromotersDrive consistent gene expressionpRpsM (strong), pKanR (weak)50-fold expression range
Inducible PromotersEnable controlled expressionpTet (aTc-inducible)Dose-dependent up to 400 ng/mL
TerminatorsPrevent transcriptional read-throughrrnB T1, BBa_BB0015>90% efficiency
Antibiotic MarkersSelection for plasmid retentionKanamycin (KanR), Chloramphenicol (CamR)Stable under autotrophic growth

These tools allow precise tuning of CobS expression levels, critical for avoiding metabolic bottlenecks or cofactor imbalances observed in other systems .

Enzymatic Role in Cobalamin Biosynthesis

CobS functions in the aerobic cobalamin pathway, working alongside CobT and CobN to convert hydrogenobyrinic acid a,c-diamide (HBAD) into adenosylcobinamide-phosphate (AdoCbi-P). Key findings from homologous systems (Rhodobacter capsulatus, Salmonella typhimurium) include:

  • Catalytic Mechanism: CobS transfers the nucleotide moiety from GTP to the corrin ring, forming the α-glycosidic bond .

  • Cofactor Dependence: Requires adenosylcobalamin (AdoCbl) as a cofactor, with inactivation rates influenced by oxidative stress .

  • Cross-Species Compatibility: X. autotrophicus CobS is hypothesized to share functional homology with CobS from R. capsulatus, which achieves 21.96 µg vitamin B12_{12}/g DCW in engineered E. coli .

Table 2: CobS Performance in Engineered Systems

OrganismCobalamin Yield (µg/g DCW)Key Mutations/EnhancementsReference
E. coli (R. capsulatus CobS)307.00Cobalt chelatase optimization
X. autotrophicus (Native)N/ARequires genetic toolkit validation

Challenges in Recombinant Expression

  • Cofactor Instability: Oxidative conversion of AdoCbl to hydroxocobalamin (OH2_2Cbl) during turnover can inactivate CobS, as observed in X. autotrophicus IcmF mutants .

  • Metabolic Burden: Overexpression of CobS in E. coli disrupts membrane potential, necessitating balanced co-expression with chaperones like CobC or PspA .

  • Host Optimization: X. autotrophicus’s autotrophic growth conditions (CO2_2, H2_2, N2_2) may require tailored expression systems to maintain enzyme activity .

Applications and Future Directions

Recombinant CobS holds promise for:

  1. Bioremediation: Enhancing dehalogenation pathways in X. autotrophicus to degrade chlorinated pollutants .

  2. Sustainable Nutrition: Enabling microbial production of vitamin B12_{12} from gases (H2_2, CO2_2), as demonstrated in electrochemical systems .

  3. Industrial Synthesis: Scaling cobalamin production via metabolic engineering, as achieved in E. coli with >250-fold yield improvements .

Research Gaps and Opportunities

  • Structural Characterization: No resolved structures of X. autotrophicus CobS exist; homology modeling using R. capsulatus (PDB: 6XG8) is recommended.

  • Dynamic Regulation: Inducible systems like pTet require further optimization under autotrophic conditions .

  • Cofactor Engineering: Stabilizing AdoCbl via redox-balanced fermentation could mitigate inactivation .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you require a specific format, please indicate your preference in the order notes. We will prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery times.
Note: All protein shipments are standardly accompanied by blue ice packs. If dry ice shipping is required, please contact us in advance for arrangement, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure all contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, the shelf life for liquid form is 6 months at -20°C/-80°C. The shelf life for lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type preference, please inform us and we will prioritize developing the specified tag.
Synonyms
cobS; Xaut_4260; Adenosylcobinamide-GDP ribazoletransferase; Cobalamin synthase; Cobalamin-5'-phosphate synthase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-265
Protein Length
full length protein
Species
Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2)
Target Names
cobS
Target Protein Sequence
MQLDRIAQDLVAALRFYSRLPLPAGRDDPDAFAVPSLNRIAYAIPLAGAVIGLIGAVVLV GALALKLPAFLASVLAVTALVLTTGAFHEDGLADTADGLGGGRDKAQRLAIMRDSRIGTY GGCALILALLLRVAALEALVASAGMFRAALALVVAEAASRAAGVLLLLALPPARADGAGA SFGRPSESAGLACALVAALLVVVILVPGFGISTAFAGLIAPLVALFAMMRLSGRLIGGQT GDVAGATQQVAVIVFLLGVLIFPGR
Uniprot No.

Target Background

Function
Catalyses the joining of adenosylcobinamide-GDP and alpha-ribazole to produce adenosylcobalamin (Ado-cobalamin). Additionally, it synthesizes adenosylcobalamin 5'-phosphate from adenosylcobinamide-GDP and alpha-ribazole 5'-phosphate.
Database Links
Protein Families
CobS family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Cobalamin synthase (cobS) and what is its primary function?

Cobalamin synthase (cobS; EC 2.7.8.26) is a polytopic integral membrane protein that catalyzes the penultimate step in the biosynthesis of vitamin B12 (cobalamin). Specifically, it condenses AdoCbi-GDP (the activated form of the corrin ring) and α-ribazole-phosphate (the activated form of 5,6-dimethylbenzimidazole) to yield AdoCbl-P (adenosylcobalamin phosphate) . This enzyme is essential for the completion of the cobalamin biosynthetic pathway in bacteria and archaea that synthesize cobamides de novo, including Xanthobacter autotrophicus .

The primary sequence of X. autotrophicus cobS consists of 265 amino acids with multiple transmembrane domains, which explains its localization to the cell membrane . The membrane association of cobS appears to be crucial for its function, suggesting that cobalamin biosynthesis occurs in proximity to or directly at the cell membrane .

What is the relationship between cobS and the biosynthesis of vitamin B12?

CobS plays a critical role in the "late" steps of cobalamin biosynthesis, which involve the assembly of the complete cobalamin structure. The biosynthetic pathway involves approximately 30 enzymes, with five comprising these "late" steps . The pathway can be conceptualized as having three branches:

  • Corrin ring activation: AdoCbi-P is guanylylated to yield AdoCbi-GDP by the CobU enzyme

  • Nucleobase activation: The phosphoribosyltransferase (CobT) activates DMB by transferring the phosphoribosyl moiety of nicotinate mononucleotide

  • Final assembly: CobS condenses AdoCbi-GDP and α-ribazole-phosphate to yield AdoCbl-P

The final step is the dephosphorylation of AdoCbl-P by CobC phosphatase to yield adenosylcobalamin (AdoCbl) . This sequential process demonstrates that cobS functions as part of a coordinated enzymatic pathway where the timing and localization of each reaction is likely regulated to ensure efficient vitamin B12 production.

How does X. autotrophicus use cobalamin in its metabolism?

X. autotrophicus is a Gram-negative diazotrophic bacterium capable of nitrogen fixation and chemolithoautotrophic growth using H2 under microaerobic conditions (<5% O2) . While the search results don't explicitly detail how X. autotrophicus utilizes cobalamin, this vitamin serves as an essential cofactor for several metabolic enzymes that might be critical for:

  • Nitrogen fixation processes

  • Carbon fixation pathways

  • Methylation reactions

  • Various other metabolic processes that require methyl transfers or radical-based chemistry

Given that X. autotrophicus can function in diverse environments and has applications in bioremediation and sustainable protein and fertilizer production , the cobalamin-dependent enzymes likely play roles in these specialized metabolic capabilities.

What are the consequences of cobS overexpression on bacterial physiology?

Overexpression of cobS in bacterial systems results in several detrimental effects on cell physiology:

  • Dissipation of the proton motive force (PMF): Elevated levels of cobS cause significant disruption to the PMF, as evidenced by increased ethidium bromide accumulation in cells expressing cobS .

  • Increased membrane permeability: Cells overexpressing cobS show significantly increased uptake of TO-PRO-3, indicating compromised membrane integrity .

  • Membrane depolarization: Measurements using carbocyanine dye (DiOC2) demonstrate that cobS overproduction leads to membrane depolarization .

  • Reduced cell viability: A dose-dependent decrease in colony-forming units is observed with increasing levels of cobS expression. At 1 mM IPTG induction, cell viability decreases significantly compared to control cells .

  • Cell division defects: Microscopic examination reveals that cobS-overexpressing cells lack normal divisional septa and exhibit elongated morphology, indicating disruption of cell division processes, potentially due to PMF-dependent divisome localization issues .

These physiological effects occur with both catalytically active wild-type cobS and the inactive D82A mutant variant, suggesting that the membrane disruption is related to the protein's membrane association rather than its enzymatic activity .

How does cobS interact with other proteins in the cobalamin biosynthetic pathway?

Evidence suggests that cobS functions as part of a multienzyme complex anchored to the cell membrane:

  • CobC phosphatase interaction: CobC, which catalyzes the final step of cobalamin biosynthesis (dephosphorylation of AdoCbl-P), appears to interact with cobS. In vitro evidence demonstrates that CobC association with liposomes depends on the presence of cobS in the liposome . Hydropathy analysis of E. coli CobC identified a potential transmembrane domain between residues 143-168, supporting its membrane association and interaction with cobS .

  • PspA interaction: Phage shock protein A (PspA) is upregulated in response to cobS overproduction. PspA plays a role in PMF maintenance, and balanced co-expression of PspA with cobS ameliorates the detrimental effects of cobS overexpression .

  • Potential multienzyme complex: The evidence supports a model where cobS anchors a multienzyme complex responsible for the assembly of vitamin B12 and other cobamides. This complex likely includes CobC and potentially other enzymes involved in the late steps of cobalamin biosynthesis .

The balanced expression of these interacting proteins appears crucial for maintaining cell viability while enabling efficient cobalamin biosynthesis.

What is the evolutionary significance of membrane-bound cobS across bacterial and archaeal species?

The polytopic integral membrane nature of cobS is conserved across all bacteria and archaea that synthesize cobamides de novo, suggesting fundamental evolutionary importance . This conservation points to several potential evolutionary advantages:

  • Compartmentalization of biosynthesis: Membrane localization may provide a specialized microenvironment for the efficient assembly of complex cobamide molecules.

  • Coordination of multienzyme complexes: The membrane may serve as a scaffold for organizing multiple enzymes in the pathway into functional complexes.

  • Protection of reactive intermediates: Membrane association may shield reactive biosynthetic intermediates from unintended reactions in the cytoplasm.

  • Coupling to energy systems: The membrane localization might facilitate coupling of cobalamin biosynthesis to membrane-associated energy generation systems.

The conserved membrane association of both cobS and CbiB (which catalyzes an earlier step in the pathway) across diverse prokaryotic lineages suggests that the nucleotide loop assembly (NLA) pathway for cobalamin biosynthesis has been membrane-associated throughout prokaryotic evolution .

What are the optimal conditions for expressing recombinant X. autotrophicus cobS?

Based on the research data, successful expression of recombinant X. autotrophicus cobS requires careful consideration of several factors:

  • Expression system: While E. coli has been used as an expression host, it's critical to use an inducible system with tight regulation to prevent premature expression that could be toxic to cells .

  • Induction conditions: Lower concentrations of inducer (IPTG) are recommended to balance protein expression with cell viability. Excessive induction (≥0.5 mM IPTG) leads to significant cell death .

  • Co-expression strategy: Balanced co-expression of cobS with either CobC phosphatase or PspA using dual expression vectors (such as pRSFDUET-1) significantly improves cell viability and reduces membrane disruption .

  • Growth conditions: Given the membrane-disrupting effects of cobS, slower growth at lower temperatures (e.g., 16-25°C rather than 37°C) might improve protein yield and cell viability.

  • Membrane fraction processing: Since cobS is a membrane protein, specialized protocols for membrane fraction isolation and solubilization with appropriate detergents would be necessary for downstream purification.

When working with the purified recombinant protein, proper storage conditions include keeping it in Tris-based buffer with 50% glycerol, and storage at -20°C or -80°C for extended periods while avoiding repeated freeze-thaw cycles .

What approaches can be used to assay cobS enzyme activity?

Several methodological approaches can be employed to assay cobS activity:

  • Liposome-based assays: Previous research has used liposomes for functional analysis of the polytopic cobS enzyme . This approach involves reconstituting purified cobS into liposomes and measuring its ability to catalyze the condensation of AdoCbi-GDP and α-ribazole-phosphate.

  • Membrane preparation assays: Quantification of cobamide synthase activity has been performed in membrane preparations from methanogenic archaea . This approach could be adapted for recombinant systems.

  • Substrate-product conversion analysis: Using HPLC or LC-MS to monitor the conversion of substrates (AdoCbi-GDP and α-ribazole-phosphate) to products (AdoCbl-P).

  • Coupled enzyme assays: A coupled assay with CobC phosphatase could monitor the complete conversion to the final AdoCbl product.

  • Radioactive substrate incorporation: Using radiolabeled substrates to track the formation of AdoCbl-P with high sensitivity.

When designing such assays, it's important to consider the membrane requirements of the enzyme and potentially include appropriate lipids and buffer conditions that mimic the native environment of cobS.

How can researchers study the interaction between cobS and other proteins in the cobalamin biosynthetic pathway?

Several techniques can be employed to study protein-protein interactions involving cobS:

  • Co-immunoprecipitation: Using tagged versions of cobS to pull down interacting proteins from cell lysates, followed by mass spectrometry identification.

  • Bacterial two-hybrid systems: Modified for membrane proteins to detect interactions between cobS and other components of the pathway.

  • Liposome reconstitution studies: As demonstrated in the research, studying the dependence of CobC association with liposomes on the presence of cobS .

  • Fluorescence resonance energy transfer (FRET): Using fluorescently labeled proteins to detect proximity-based interactions in membrane environments.

  • Cross-linking coupled with mass spectrometry: To identify proteins in close proximity to cobS within the membrane.

  • Co-expression studies: Monitoring the effects of co-expressing cobS with other proteins (like CobC and PspA) on cell viability, membrane integrity, and enzyme activity .

  • Microscopy techniques: Using fluorescently tagged proteins to visualize co-localization of cobS with other components of the cobalamin biosynthetic pathway.

These approaches can help elucidate the proposed multienzyme complex anchored by cobS in the cell membrane.

How can researchers distinguish between the effects of cobS catalytic activity versus its membrane-disrupting properties?

The research findings present an interesting case where both the catalytic function and membrane association of cobS need to be distinguished. Researchers can employ several strategies:

  • Catalytically inactive mutants: The D82A mutant of cobS, which is catalytically inactive but still disrupts membrane integrity, provides a valuable tool for distinguishing between these effects . Comparison of wild-type cobS with this mutant in various assays can help separate enzymatic activity from membrane disruption.

  • Correlation analysis: Plotting enzyme activity levels against membrane disruption metrics (e.g., EtBr accumulation, TO-PRO-3 uptake, DiOC2 fluorescence) for various cobS expression levels can reveal whether these effects are proportionally linked or independent.

  • Domain-specific mutations: Creating targeted mutations in different regions of cobS (transmembrane domains versus catalytic regions) can help map which portions of the protein are responsible for different cellular effects.

  • Time-course studies: Monitoring the temporal relationship between cobS expression, enzymatic activity, and membrane disruption can reveal causative relationships.

  • Sub-cellular fractionation: Analyzing the distribution of cobS and its effects in different membrane fractions could provide insights into the specific membrane domains affected.

This differentiation is crucial for understanding the dual roles of cobS and designing expression systems that maintain its catalytic function while minimizing cellular toxicity.

What explains the apparent paradox of cobS essentiality versus its toxicity when overexpressed?

The data presents an apparent paradox: cobS is essential for cobalamin biosynthesis yet toxic when overexpressed. This can be explained by several hypotheses:

  • Balanced stoichiometry requirement: The toxicity of cobS overexpression and its amelioration by co-expression of CobC suggests that a specific stoichiometric balance between components of the cobalamin biosynthetic machinery is critical . When cobS is overexpressed alone, this balance is disrupted.

  • Membrane space limitation: As a membrane protein, excessive amounts of cobS may overwhelm the membrane's capacity to accommodate proteins while maintaining structural integrity.

  • PMF disruption mechanism: The insertion of excess cobS into the membrane may create proton leakage channels or disrupt existing PMF-generating systems .

  • Multienzyme complex assembly: If cobS normally functions within a multienzyme complex, overexpression without corresponding increases in partner proteins may result in incomplete complexes that disrupt membrane function.

  • Feedback regulation: Natural expression of cobS likely includes feedback mechanisms that are bypassed during recombinant overexpression.

This paradox highlights the importance of studying cobS in its native context and developing expression systems that maintain appropriate levels and stoichiometry of all components involved in cobalamin biosynthesis.

How do findings on X. autotrophicus cobS relate to practical applications in nitrogen fixation and bioremediation?

The research on X. autotrophicus cobS has several implications for practical applications:

  • Enhanced nitrogen fixation: X. autotrophicus is a diazotrophic bacterium capable of nitrogen fixation under microaerobic conditions . Since cobalamin-dependent enzymes may be involved in this process, optimized expression of functional cobS could potentially enhance nitrogen fixation capabilities.

  • Sustainable fertilizer production: X. autotrophicus has been studied for its ability to release NH4+ and PO4³- and its compatibility with sustainable fertilizers like human urine . Understanding the role of cobS in these processes could lead to improved biofertilizer applications.

  • Metabolic engineering: Knowledge of the cobalamin biosynthetic pathway, including the role of cobS, enables metabolic engineering approaches to enhance vitamin B12 production or modify X. autotrophicus for specific bioremediation applications.

  • Bioremediation applications: X. autotrophicus has applications in bioremediation , potentially involving cobalamin-dependent enzymes in the degradation of environmental pollutants. Understanding cobS function could lead to improved bioremediation strains.

  • Controlled ammonia excretion: Research shows that X. autotrophicus can be induced to excrete NH3 directly by inhibiting the NH3 assimilation pathway . The relationship between this process and cobalamin-dependent metabolism could be explored for engineered nitrogen release systems.

In each case, the careful balance of cobS expression with other cellular components would be crucial to develop functional applications without triggering the deleterious effects observed with cobS overexpression.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.