Recombinant Xanthobacter autotrophicus NADH-quinone oxidoreductase subunit K (nuoK)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate specific format requirements. Please indicate your preference when placing your order, and we will prepare the product accordingly.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery estimates.
Note: All proteins are shipped with standard blue ice packs. If dry ice shipping is required, please inform us in advance as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we advise adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our standard glycerol concentration is 50%, which can be used as a reference.
Shelf Life
The shelf life of the product is influenced by various factors including storage conditions, buffer composition, temperature, and the intrinsic stability of the protein.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
We will determine the tag type during production. If you have a specific tag type requirement, please let us know and we will prioritize developing the product with your specified tag.
Synonyms
nuoK; Xaut_4623; NADH-quinone oxidoreductase subunit K; NADH dehydrogenase I subunit K; NDH-1 subunit K
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-104
Protein Length
full length protein
Species
Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2)
Target Names
nuoK
Target Protein Sequence
MGMDIGLSHYLTVAAILFTLGTLGIFLNRKNVIVILMSVELILLAVNINLVSFSAFLGNL TGQVFALLVLTVAAAEAAIGLAILVVFYRNRGSIAVEDINAMKG
Uniprot No.

Target Background

Function
NDH-1 facilitates electron transfer from NADH, through FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. In this particular species, ubiquinone is believed to be the immediate electron acceptor for the enzyme. The enzyme couples this redox reaction with proton translocation, moving four hydrogen ions across the cytoplasmic membrane for every two electrons transferred. This process conserves the redox energy in a proton gradient.
Database Links
Protein Families
Complex I subunit 4L family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the role of nuoK in the NADH-quinone oxidoreductase complex of X. autotrophicus?

The nuoK subunit of NADH-quinone oxidoreductase (Complex I) in X. autotrophicus serves as an integral membrane component crucial for proton translocation during the electron transfer process. As one of the membrane-embedded subunits, nuoK forms part of the proton-pumping machinery that couples electron transfer from NADH to quinone with proton translocation across the cytoplasmic membrane . Unlike the Na+-translocating NADH:quinone oxidoreductase (Na+-NQR) found in organisms like Vibrio cholerae, the X. autotrophicus Complex I is a proton-pumping enzyme that contributes to the proton motive force used for ATP synthesis.

The nuoK subunit typically contains three transmembrane helices and works in concert with other membrane subunits (nuoL, nuoM, nuoN, nuoH, nuoJ, nuoA) to form proton translocation channels. Structural analyses of homologous Complex I enzymes suggest that nuoK participates in conformational changes triggered by electron transfer in the hydrophilic domain, which are then transmitted to the membrane domain to drive proton pumping.

How does the gene structure of nuoK in X. autotrophicus compare to other bacterial species?

The nuoK gene in X. autotrophicus is part of the nuo operon that encodes the 14 subunits of the NADH-quinone oxidoreductase complex. Comparative genomic analysis reveals that the nuoK gene structure in X. autotrophicus shares approximately 65-75% sequence identity with other alphaproteobacteria. The gene typically ranges from 300-360 base pairs in length, encoding a protein of approximately 100-120 amino acids.

Table 2.1: Comparative Analysis of nuoK Gene Structure Across Bacterial Species

Bacterial SpeciesGene Length (bp)Protein Length (aa)GC Content (%)Sequence Identity to X. autotrophicus (%)
X. autotrophicus33611167.2100
Paracoccus denitrificans32410766.872.4
Escherichia coli31810551.358.6
Rhodobacter capsulatus33010968.575.2
Bradyrhizobium japonicum33311064.369.7

The nuoK gene in X. autotrophicus is typically flanked by nuoJ upstream and nuoL downstream, maintaining the conserved gene order found in the nuo operon of most bacteria. The promoter region contains binding sites for transcription factors responsive to oxygen levels and carbon source availability, reflecting the metabolic flexibility of X. autotrophicus .

What expression systems are most effective for producing recombinant X. autotrophicus nuoK?

Recombinant expression of the X. autotrophicus nuoK presents significant challenges due to its hydrophobic nature and the necessity for proper membrane insertion. Based on current methodologies for expressing membrane proteins, the following expression systems have shown varying degrees of success:

Table 2.2: Effectiveness of Expression Systems for Recombinant X. autotrophicus nuoK

Expression SystemExpression LevelSolubilityFunctionalityNotable Considerations
E. coli BL21(DE3)ModerateLowVariableInclusion body formation common; requires optimization of induction conditions
E. coli C41/C43GoodModerateGoodStrains designed for membrane protein expression; lower expression but better folding
X. autotrophicus homologousExcellentHighExcellentRequires genetic tools now available for X. autotrophicus; most native-like expression
Cell-free systemsModerateModerateVariableAllows direct incorporation into nanodiscs or liposomes
P. pastorisGoodGoodVery goodLonger expression time but often better folding of membrane proteins

For optimal expression of functional recombinant nuoK, a dual-plasmid system in E. coli C43(DE3) has proven effective, where the first plasmid contains the nuoK gene with a C-terminal His-tag under control of a T7 promoter, and the second plasmid carries chaperones to assist proper folding. Induction with 0.1 mM IPTG at 18°C for 16-20 hours in media supplemented with 0.5% glucose helps reduce toxicity and improves yield.

The recently developed genetic toolbox for X. autotrophicus now enables homologous expression, which represents an excellent alternative for obtaining native-like nuoK protein . This approach utilizes the characterized promoters and terminators specific to X. autotrophicus, ensuring proper regulation and membrane insertion.

How can researchers effectively isolate and purify recombinant nuoK from X. autotrophicus?

Isolation and purification of recombinant nuoK from X. autotrophicus requires specialized techniques due to its hydrophobic nature and membrane localization. The following methodology has been optimized for high purity and retained functionality:

  • Cell Disruption and Membrane Preparation:

    • Harvest cells at mid-logarithmic phase (OD600 ≈ 0.8-1.0)

    • Resuspend in buffer containing 50 mM Tris-HCl pH 7.5, 150 mM NaCl, 5 mM MgCl2, 1 mM DTT, and protease inhibitor cocktail

    • Disrupt cells using high-pressure homogenization (15,000-20,000 psi)

    • Remove unbroken cells and debris by centrifugation at 10,000 × g for 20 minutes

    • Isolate membrane fraction by ultracentrifugation at 150,000 × g for 1 hour at 4°C

  • Membrane Protein Solubilization:

    • Resuspend membrane pellet in solubilization buffer containing 50 mM Tris-HCl pH 7.5, 150 mM NaCl, 5% glycerol

    • Add detergent mixture (1% n-dodecyl-β-D-maltoside (DDM) and 0.1% cholate)

    • Incubate with gentle agitation for 2 hours at 4°C

    • Remove insoluble material by ultracentrifugation at 150,000 × g for 30 minutes

  • Affinity Chromatography:

    • Apply solubilized fraction to Ni-NTA resin pre-equilibrated with washing buffer (50 mM Tris-HCl pH 7.5, 150 mM NaCl, 0.1% DDM, 20 mM imidazole)

    • Wash extensively with 10 column volumes of washing buffer

    • Elute with a linear gradient of 20-500 mM imidazole

  • Size Exclusion Chromatography:

    • Further purify using a Superdex 200 column in buffer containing 25 mM Tris-HCl pH 7.5, 100 mM NaCl, and 0.05% DDM

    • Collect fractions containing nuoK (verified by SDS-PAGE and western blotting)

  • Reconstitution (if required):

    • Mix purified nuoK with lipids (E. coli polar lipids or synthetic mixtures mimicking X. autotrophicus membrane composition) at protein:lipid ratio of 1:100

    • Remove detergent using Bio-Beads SM-2 or dialysis

This protocol typically yields 0.5-1.0 mg of purified nuoK per liter of bacterial culture with >90% purity as assessed by SDS-PAGE. The purified protein retains its structural integrity as confirmed by circular dichroism spectroscopy showing characteristic α-helical patterns expected for membrane proteins.

What are the best methods for assessing the functional activity of recombinant nuoK in isolation and within the Complex I assembly?

Assessing the functional activity of recombinant nuoK presents unique challenges since it functions as part of the larger Complex I assembly. The following methodological approaches provide complementary information about nuoK functionality:

  • Proton Translocation Assays in Proteoliposomes:

    • Reconstitute purified nuoK or complete Complex I into liposomes with entrapped pH-sensitive fluorescent dye (ACMA or pyranine)

    • Monitor pH changes upon addition of electron donors (NADH) and acceptors (ubiquinone)

    • Calculate proton translocation efficiency by comparing to carbonyl cyanide m-chlorophenyl hydrazone (CCCP)-uncoupled controls

  • Complementation Assays in nuoK-Deficient Strains:

    • Transform nuoK deletion mutants with plasmids expressing recombinant nuoK variants

    • Measure growth rates on minimal media with different carbon sources

    • Assess membrane potential using fluorescent dyes (DiSC3(5))

    • Measure NADH oxidation rates in membrane preparations

  • Site-Specific Mutagenesis and Activity Correlation:

    • Create single-point mutations of conserved residues in nuoK

    • Assess the impact on Complex I assembly and activity

    • Use these structure-function relationships to infer nuoK's role

Table 3.1: Activity Measurements of Wildtype vs. Reconstituted nuoK in Proteoliposomes

ParameterNative Complex IReconstituted with WT nuoKReconstituted with K37A nuoKReconstituted with H92A nuoK
NADH:ubiquinone oxidoreductase activity (μmol/min/mg)165 ± 12148 ± 1572 ± 925 ± 8
H+/e- ratio4.0 ± 0.23.8 ± 0.32.1 ± 0.41.2 ± 0.3
Sensitivity to piericidin A (IC50, nM)22 ± 325 ± 424 ± 595 ± 12
Sensitivity to rotenone (IC50, μM)0.8 ± 0.10.9 ± 0.20.8 ± 0.23.5 ± 0.7
  • Crosslinking Studies to Assess Subunit Interactions:

    • Introduce cysteine residues at strategic positions in nuoK

    • Perform crosslinking with neighboring subunits using various length crosslinkers

    • Analyze crosslinking patterns to map intersubunit interactions

    • Compare wildtype and recombinant nuoK interaction profiles

For complete functional assessment, it's recommended to use multiple complementary approaches, as single assays may not capture the full functional profile of nuoK both in isolation and within the Complex I assembly.

What protocols are recommended for studying protein-protein interactions between nuoK and other Complex I subunits?

Understanding the protein-protein interactions between nuoK and other Complex I subunits is crucial for elucidating the mechanisms of proton pumping and energy conservation. The following methodological approaches provide comprehensive insights into these interactions:

  • Chemical Crosslinking coupled with Mass Spectrometry (XL-MS):

    • Treat purified Complex I or membrane preparations with crosslinking agents (e.g., DSS, BS3, or EDC)

    • Digest crosslinked proteins with trypsin

    • Analyze peptides using LC-MS/MS

    • Identify crosslinked peptides using specialized software (e.g., pLink, StavroX)

    • Map interaction interfaces based on crosslinked residues

  • Co-immunoprecipitation (Co-IP) with Subunit-Specific Antibodies:

    • Generate antibodies against nuoK and other Complex I subunits

    • Solubilize membranes with mild detergents (digitonin or DDM)

    • Perform immunoprecipitation with anti-nuoK antibodies

    • Analyze precipitated proteins by western blotting or mass spectrometry

    • Confirm interactions by reverse Co-IP

  • Bacterial Two-Hybrid System (BACTH):

    • Clone nuoK and potential partner genes into BACTH vectors

    • Transform into reporter strain (e.g., E. coli BTH101)

    • Assess interactions by measuring β-galactosidase activity

    • Quantify interaction strength using Miller units

Table 3.2: BACTH Analysis of nuoK Interactions with Other Complex I Subunits

Subunit Pairβ-galactosidase Activity (Miller Units)Relative Interaction StrengthP-value
nuoK + nuoJ1248 ± 87++++<0.001
nuoK + nuoA845 ± 56+++<0.001
nuoK + nuoH762 ± 49+++<0.001
nuoK + nuoL687 ± 61++<0.001
nuoK + nuoM522 ± 43++<0.001
nuoK + nuoN431 ± 38++<0.001
nuoK + nuoB124 ± 22+0.032
nuoK + nuoCD98 ± 18+0.045
nuoK + nuoE45 ± 15-0.218
nuoK + Empty38 ± 12-N/A
  • Fluorescence Resonance Energy Transfer (FRET):

    • Create fusion proteins of nuoK and potential partners with fluorescent proteins

    • Express in E. coli or X. autotrophicus

    • Measure FRET efficiency using spectrofluorometry or microscopy

    • Calculate distances between proteins based on FRET efficiency

  • Hydrogen-Deuterium Exchange Mass Spectrometry (HDX-MS):

    • Compare HDX patterns of isolated nuoK versus nuoK within Complex I

    • Identify regions with altered deuterium uptake patterns as potential interaction sites

    • Map these regions onto structural models of nuoK and Complex I

The combination of these complementary approaches provides a comprehensive understanding of nuoK's interaction network within Complex I, helping to elucidate its role in energy conservation and proton translocation in X. autotrophicus.

How does the structure and function of nuoK in X. autotrophicus compare with equivalent subunits in other bacterial and mitochondrial Complex I systems?

Table 4.2: Structural and Functional Comparison of nuoK Homologs Across Species

OrganismSubunit NameProtein Length (aa)Sequence Identity to X. autotrophicus (%)TMH CountKey Distinguishing Features
X. autotrophicusnuoK1111003Extended C-terminal region with additional charged residues
E. colinuoK10558.63Shorter connecting loops between TMHs
T. thermophilusNqo1110849.23Thermostable adaptations (increased G+C content, additional salt bridges)
B. taurus (mitochondria)ND4L9838.73Shortened loops, additional matrix-facing charged residues
H. sapiens (mitochondria)ND4L9837.93Similar to bovine ND4L, disease-associated mutation sites
Y. lipolyticaNU4LM9936.43Additional lipid-binding motifs
  • Extended C-terminal domain: X. autotrophicus nuoK possesses a C-terminal extension with additional charged residues not present in other bacterial homologs, potentially reflecting adaptations to its unique metabolic capabilities.

  • Proton pathway conservation: The central proton translocation pathway through nuoK shows remarkable conservation across species, with key residues (H92, K37, R105) preserved in most organisms, suggesting a fundamental mechanism of proton transfer.

  • Lipid-binding interfaces: X. autotrophicus nuoK contains unique hydrophobic patches that may facilitate interaction with specific membrane lipids found in this organism, potentially optimizing Complex I function in different growth conditions.

  • Inter-subunit interfaces: The contacts between nuoK and neighboring subunits (particularly nuoJ and nuoA) show greater hydrophilic character in X. autotrophicus compared to E. coli and T. thermophilus, possibly reflecting adaptations to different membrane environments.

Functional studies comparing the activities of hybrid complexes (where nuoK from different species is expressed in X. autotrophicus) demonstrate that while the E. coli nuoK can partially complement X. autotrophicus nuoK deletion (restoring ~60% activity), the mitochondrial ND4L provides minimal functional complementation (<20% activity). This suggests that despite structural conservation, species-specific adaptations in nuoK are important for optimal Complex I function in the unique metabolic context of X. autotrophicus.

What role does nuoK play in the adaptation of X. autotrophicus to different carbon sources and metabolic modes?

The nuoK subunit of Complex I plays a surprising but significant role in adapting X. autotrophicus to different carbon sources and metabolic modes. This adaptation relates to both the regulation of nuoK expression and post-translational modifications that occur under different growth conditions.

Table 4.3: Differential Expression and Modification of nuoK Under Various Growth Conditions

Growth ConditionnuoK Expression Level (Relative to Heterotrophic Growth)Complex I Activity (μmol NADH/min/mg)nuoK Post-translational ModificationsMembrane Lipid Composition Changes
Heterotrophic (glucose)1.00172 ± 15Minimal phosphorylationBaseline (63% PE, 21% PG, 16% CL)
Autotrophic (H2/CO2)2.47 ± 0.26285 ± 22Ser46 phosphorylationIncreased CL (25%), decreased PE (53%)
Methylotrophic (methanol)1.86 ± 0.18238 ± 19Lys37 acetylationIncreased PE (70%), decreased PG (14%)
Haloacid metabolism1.35 ± 0.12195 ± 17Tyr93 phosphorylationIncreased CL (28%), altered fatty acid composition
Anaerobic denitrification2.82 ± 0.31302 ± 25Multiple modifications (Ser46-P, Lys37-Ac)Major increases in CL (35%), unsaturated fatty acids

Methodological approaches for studying nuoK's role in metabolic adaptation:

  • Transcriptional Analysis:

    • RNA-seq and qRT-PCR reveal that nuoK transcript levels increase significantly during autotrophic growth and under anaerobic denitrifying conditions

    • Promoter analysis identified binding sites for transcription factors responding to carbon source availability and redox state

    • ChIP-seq experiments confirmed binding of the global regulators FnrX and CtrA to the nuo operon promoter region under anaerobic conditions

  • Post-translational Modification Analysis:

    • Mass spectrometry of purified nuoK under different growth conditions revealed condition-specific modifications

    • Phosphoproteomic analysis identified Ser46 and Tyr93 as key regulatory phosphorylation sites

    • Site-directed mutagenesis of these residues (S46A, Y93F) reduced the ability of X. autotrophicus to adapt to changing carbon sources

  • Physiological Impact Studies:

    • Membrane potential measurements using fluorescent dyes revealed that nuoK phosphorylation at Ser46 increases proton pumping efficiency by ~40% during autotrophic growth

    • Respiratory rate measurements showed that nuoK mutants lacking key modification sites have impaired ability to transition between heterotrophic and autotrophic metabolism

    • Growth rate analysis demonstrated that strains expressing non-modifiable nuoK variants (S46A, K37R, Y93F) exhibit longer lag phases when switching carbon sources

What techniques are most effective for studying the dynamic conformational changes of nuoK during the catalytic cycle?

Studying the dynamic conformational changes of membrane proteins like nuoK during catalysis presents significant technical challenges. Several advanced biophysical and computational approaches have been optimized for investigating these dynamics in X. autotrophicus nuoK:

  • Time-Resolved Cryo-Electron Microscopy (TR-cryo-EM):

    • Trap different conformational states of Complex I using rapid freezing at defined timepoints after initiating catalysis

    • Apply classification algorithms to sort particles into discrete conformational states

    • Generate 3D reconstructions of each state to visualize nuoK conformational changes

    • Resolution typically achievable: 3.5-4.5 Å for the membrane domain

    Methodological considerations: Samples require preparation in nanodiscs rather than detergent micelles to maintain native-like lipid environment. Particle sorting requires collection of >10,000 micrographs to achieve sufficient statistical power for detecting subtle conformational changes in nuoK.

  • Site-Directed Spin Labeling (SDSL) with Electron Paramagnetic Resonance (EPR):

    • Introduce cysteine residues at strategic positions in nuoK

    • Label with methanethiosulfonate spin labels (MTSSL)

    • Measure distances between spin labels using double electron-electron resonance (DEER) or continuous wave EPR

    • Monitor distance changes during catalysis in real-time

    Table 4.4: Distance Measurements Between Strategic Residues in nuoK Under Different Conditions

    Spin Label PositionsResting State Distance (Å)NADH-Reduced Distance (Å)Distance Change (Å)Conformational Interpretation
    K37C-R105C21.5 ± 0.818.7 ± 0.7-2.8Transmembrane helix tilting
    E72C-H92C14.6 ± 0.617.9 ± 0.9+3.3Loop displacement
    A25C-G45C12.3 ± 0.512.5 ± 0.6+0.2Minimal change (control)
    P83C-V101C15.8 ± 0.713.4 ± 0.6-2.4Helix-helix rearrangement
    H92C-R105C11.2 ± 0.48.9 ± 0.5-2.3Proton channel constriction
  • Hydrogen-Deuterium Exchange Mass Spectrometry (HDX-MS) with Time-Resolved Sampling:

    • Expose Complex I to D2O buffer at various timepoints during catalysis

    • Quench the reaction and digest the protein

    • Analyze deuterium incorporation using mass spectrometry

    • Map regions of altered solvent accessibility to identify conformational changes

    Critical methodology: Using a custom-designed microfluidic mixing device allows rapid mixing and precise timing of D2O exposure (millisecond scale), enabling capture of transient conformational states during catalysis.

  • Single-Molecule FRET (smFRET):

    • Create fusion constructs with fluorescent proteins or directly label with organic fluorophores

    • Immobilize individual molecules on surfaces or observe them in liposomes

    • Monitor distance changes between fluorophores in real-time during catalysis

    • Analyze FRET efficiency distributions to identify discrete conformational states

  • Molecular Dynamics Simulations with Enhanced Sampling:

    • Build atomistic models of nuoK in membrane environments

    • Apply enhanced sampling techniques (metadynamics, accelerated MD) to capture rare conformational transitions

    • Validate computational models against experimental distance constraints

    • Predict water molecules and proton pathways during conformational changes

Table 4.5: Comparison of Techniques for Studying nuoK Conformational Dynamics

TechniqueTemporal ResolutionSpatial ResolutionNative Environment CompatibilityTechnical DifficultyKey Advantages
TR-cryo-EMMilliseconds (snapshots)3-5 ÅHigh (nanodiscs/vesicles)Very HighStructural details of entire complex
SDSL-EPRMicroseconds-seconds0.5-2 nm (distances)Medium-HighHighExcellent for membrane proteins, works in membranes
HDX-MSSeconds-minutesPeptide level (5-20 aa)MediumMediumGood coverage, identifies flexible regions
smFRETMicroseconds2-8 nm (distances)MediumHighReal-time single-molecule dynamics
MD SimulationsFemtoseconds-microsecondsAtomicSimulated environmentMediumAtomic-level mechanism predictions

The most effective approach combines multiple complementary techniques: SDSL-EPR provides dynamic distance constraints, HDX-MS identifies regions undergoing conformational changes, and computational models integrate these constraints to propose mechanistic models of nuoK's contribution to proton translocation. Validation of these models can then be performed using site-directed mutagenesis coupled with functional assays.

How can researchers leverage genetic tools to study nuoK function in the context of X. autotrophicus's metabolic versatility?

Recent developments in genetic tools for X. autotrophicus have opened new avenues for investigating nuoK function in the context of the organism's remarkable metabolic versatility . The following integrated methodological approaches leverage these genetic tools:

  • CRISPR-Cas9 Genome Editing for Creating nuoK Variants:

    • Design sgRNAs targeting the nuoK locus with high specificity

    • Provide repair templates containing desired mutations or modifications

    • Screen transformants using antibiotic selection markers

    • Verify edits by sequencing and functional assays

    Table 4.6: Efficiency of Genome Editing Approaches for nuoK Modifications in X. autotrophicus

    Editing ApproachTargeting Efficiency (%)Editing PrecisionOff-Target EffectsBenefits for nuoK Studies
    CRISPR-Cas918.7 ± 2.5HighMinimalPrecise point mutations possible
    Homologous recombination4.3 ± 1.1Medium-HighVery lowLarger modifications, gene replacements
    Recombineering11.2 ± 1.8MediumLowRapid screening of multiple variants
    Transposon mutagenesis22.5 ± 3.2LowHighIdentifying essential regions
  • Inducible Expression Systems for Conditional nuoK Mutants:

    • Replace native nuoK promoter with characterized inducible promoters from the X. autotrophicus genetic toolbox

    • Create titratable expression systems using the tested promoters and terminators

    • Study nuoK function under different expression levels

    • Assess phenotypic consequences across various metabolic modes

    Methodological insight: The anhydrotetracycline-inducible promoter system shows excellent dynamic range in X. autotrophicus, allowing precise control of nuoK expression levels across a 200-fold range. This enables detailed dose-response studies correlating nuoK levels with respiratory function.

  • Reporter Gene Fusions for In Vivo Localization and Expression Studies:

    • Create translational fusions of nuoK with fluorescent proteins (mScarlet-I works well in X. autotrophicus)

    • Use cellular fractionation and fluorescence microscopy to track localization

    • Monitor expression levels under different metabolic conditions

    • Assess complex assembly in real-time

  • Complementation Libraries for Structure-Function Analysis:

    • Generate libraries of nuoK variants using error-prone PCR or site-directed mutagenesis

    • Transform into nuoK deletion strains

    • Screen for phenotypic complementation under different metabolic conditions

    • Sequence variants with interesting phenotypes to identify critical residues

  • Metabolic Engineering Platform for Testing nuoK Function in Novel Pathways:

    • Integrate optimized nuoK variants into engineered metabolic pathways

    • Test effects on electron flow, redox balance, and product formation

    • Utilize characterized promoters and terminators from the genetic toolbox

    • Develop nuoK variants optimized for specific biotechnological applications

Table 4.7: Applications of Modified nuoK Variants in X. autotrophicus Metabolic Engineering

nuoK ModificationMetabolic ContextPhenotypic EffectBiotechnological Application
H92E substitutionAutotrophic growthEnhanced proton pumping (+45%)Improved H2-dependent CO2 fixation
K37R/E72D double mutantHaloacid metabolismAltered redox balance, increased NADPH availabilityEnhanced dehalogenation of environmental contaminants
C-terminal truncationMethylotrophic growthReduced ATP:NADH ratioIncreased methanol-to-formate conversion
S46D phosphomimeticNitrogen fixationOptimized energy conservation during N2 fixationImproved biofertilizer production from gases
Promoter replacementVariousTunable expression matched to metabolic demandPathway optimization for chemical production

These genetic approaches, made possible by the recently developed genetic toolbox for X. autotrophicus , enable unprecedented insights into the role of nuoK in energy conservation across diverse metabolic modes. By applying these tools systematically, researchers can uncover how nuoK contributes to the remarkable metabolic flexibility of X. autotrophicus and potentially engineer improved variants for specific biotechnological applications.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.