Recombinant Xanthomonas axonopodis pv. citri C4-dicarboxylate transport protein (dctA)

Shipped with Ice Packs
In Stock

Description

Introduction to Xanthomonas axonopodis pv. citri and the dctA Protein

Xanthomonas axonopodis pv. citri (Xac) is a gram-negative bacterial phytopathogen responsible for citrus canker, one of the most devastating diseases affecting citrus crops worldwide . The pathogen employs various proteins and molecular factors to facilitate infection, colonization, and disease progression in host plants. Among these proteins, the C4-dicarboxylate transport protein (dctA) plays a significant role in bacterial metabolism and potentially in the pathogenesis process.

The dctA protein (UniProt ID: Q8PGZ1) functions as a transmembrane transporter that facilitates the movement of C4-dicarboxylates across the bacterial cell membrane . C4-dicarboxylates are four-carbon organic acids that serve as important intermediates in cellular metabolism. By enabling the transport of these compounds, dctA contributes to the metabolic flexibility of Xanthomonas axonopodis pv. citri, potentially enhancing its ability to survive in diverse environments, including plant tissues during infection.

Gene Information and Classification

The dctA gene in Xanthomonas axonopodis pv. citri is identified by the locus tag XAC3471 . This gene encodes the C4-dicarboxylate transport protein and is synonymous with the notation "C4-dicarboxylate transport protein" in genomic databases. The protein belongs to the dicarboxylate transporter family, a group of membrane proteins specialized in the transport of dicarboxylic acids.

Gene InformationDetails
Gene NamedctA
SynonymsXAC3471; C4-dicarboxylate transport protein
UniProt IDQ8PGZ1
Protein Length457 amino acids (full length)
OrganismXanthomonas axonopodis pv. citri

Expression Systems and Production Methods

The recombinant Xanthomonas axonopodis pv. citri C4-dicarboxylate transport protein is typically produced using Escherichia coli expression systems . The full-length dctA gene (encoding amino acids 1-457) is cloned into appropriate expression vectors and transformed into E. coli for protein production. To facilitate purification and detection, the recombinant protein is often fused with affinity tags, most commonly a polyhistidine (His) tag attached to the N-terminus .

Functional Role in Xanthomonas axonopodis pv. citri Biology

The dctA protein in Xanthomonas axonopodis pv. citri functions primarily as a C4-dicarboxylate transport protein, facilitating the movement of C4-dicarboxylates across the bacterial cell membrane. These compounds, which include succinate, fumarate, and malate, are important intermediates in central metabolic pathways such as the tricarboxylic acid (TCA) cycle.

While the specific contribution of dctA to Xanthomonas axonopodis pv. citri virulence has not been explicitly characterized in the available research, studies on related bacterial systems suggest that metabolic adaptability and efficient nutrient acquisition are important factors in bacterial pathogenesis. The ability to transport and utilize diverse carbon sources, including C4-dicarboxylates, may provide Xanthomonas axonopodis pv. citri with a metabolic advantage during infection and colonization of citrus plants.

Research Applications and Significance

Recombinant dctA from Xanthomonas axonopodis pv. citri has several important applications in research and biotechnology. As a membrane transport protein from a significant plant pathogen, it serves as a valuable tool for studying bacterial metabolism, membrane transport mechanisms, and potentially host-pathogen interactions.

In the broader context of Xanthomonas axonopodis pv. citri research, understanding the roles of various bacterial components is crucial for developing effective strategies against citrus canker. Studies have shown that other bacterial factors, such as lipopolysaccharide (LPS), play significant roles in virulence and in triggering plant defense responses . While dctA's specific role in pathogenesis remains to be fully elucidated, it represents an important component of the bacterial metabolic machinery that potentially contributes to the pathogen's fitness during infection.

Additionally, recombinant dctA can be used for:

  1. Structure-function studies of bacterial transport proteins

  2. Development of antibodies for research and diagnostic purposes

  3. Screening of compounds that may inhibit bacterial transport functions

  4. Comparative studies with transport proteins from other bacterial species

Reconstitution Protocol

For reconstitution, it is recommended to:

  1. Briefly centrifuge the vial prior to opening to bring the contents to the bottom

  2. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  3. Add glycerol to a final concentration of 5-50% for long-term storage (50% is commonly used)

  4. Prepare multiple small aliquots to minimize freeze-thaw cycles

Repeated freezing and thawing should be avoided as it can lead to protein denaturation and loss of activity .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement. We will accommodate your request whenever possible.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timelines.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is discouraged. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can be used as a reference for your own preparations.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
Tag type is determined during production. If you have specific tag requirements, please inform us, and we will prioritize developing the specified tag.
Synonyms
dctA; XAC3471; C4-dicarboxylate transport protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-457
Protein Length
full length protein
Species
Xanthomonas axonopodis pv. citri (strain 306)
Target Names
dctA
Target Protein Sequence
MHISKPAGPLPASVPFYRQLYFQVVVAIVLGALLGHFEPAFAESLKPLGDAFIKLVKMII APVIFLTIVTGIAGMTHLKTVGRVFGKAMAYFLFFSTLALVVGLVVAHVVQPGAGMNINP ADLDQSAVKSYVEKSHDLTLVGFLMDIIPNSLIGAFTGDQVVNGKLTGPNILQVLFVAVL FGVSLALVGERGKPVLNLLEALIAPVFKLVHILMRAAPIGAFGAIAFTIGKYGVESLVNL AWLVGSFYLTSLLFVLVILGLVSRLCGFSVLKLIRYLKAELLLVLGTSSSESALPSLMEK MEKAGCEKSVVGLVVPTGYSFNLDGTNIYMTLAALFIAQATNTELTLGHQIALLAVAMLS SKGAAGVTGAGFITLAATLAVVPEVPVAGMALILGVDRFMSECRSLTNFIGNAVATVVVS RWENALDRDRLKLVLDGGEPPLLAPVGQPGVAPASLR
Uniprot No.

Target Background

Function
This protein is responsible for transporting dicarboxylates, such as succinate, fumarate, and malate, from the periplasm across the membrane.
Database Links

KEGG: xac:XAC3471

STRING: 190486.XAC3471

Protein Families
Dicarboxylate/amino acid:cation symporter (DAACS) (TC 2.A.23) family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the basic structure and function of dctA in Xanthomonas axonopodis pv. citri?

The C4-dicarboxylate transport protein (dctA) in Xanthomonas axonopodis pv. citri functions as a membrane transporter responsible for the uptake of C4-dicarboxylates such as malate, fumarate, and succinate from the external environment. Structurally, dctA belongs to the dicarboxylate/amino acid:cation symporter (DAACS) family, containing multiple transmembrane domains that form a channel through which dicarboxylates are transported. This protein plays a critical role in carbon metabolism of Xac during colonization of citrus hosts, as these dicarboxylates serve as important carbon and energy sources during infection processes. The functional characterization of dctA reveals its importance in bacterial adaptation to changing nutrient conditions in plant tissues .

How does dctA contribute to bacterial metabolism during host colonization?

During host colonization, dctA enables Xanthomonas axonopodis pv. citri to utilize plant-derived C4-dicarboxylates as carbon sources. Plant tissues contain significant amounts of dicarboxylates, particularly in the apoplast and cytosol. When bacteria invade the host, dctA facilitates the uptake of these compounds, providing essential nutrients for bacterial growth and proliferation. This metabolic adaptation is particularly important during the early stages of infection when the bacterium is establishing itself in the plant tissue and needs to compete with host cells for nutrients. Research suggests that dctA-dependent metabolism might be linked to the bacterium's ability to cause disease symptoms, as interference with dicarboxylate transport can affect bacterial fitness and virulence in plant hosts .

What are the optimal conditions for cloning the dctA gene from Xanthomonas axonopodis pv. citri?

Optimal cloning of the dctA gene from Xanthomonas axonopodis pv. citri requires careful consideration of several factors. Begin by designing primers that incorporate appropriate restriction enzyme sites compatible with your expression vector, with 5-10 nucleotide overhangs to enhance restriction enzyme efficiency. For PCR amplification, use high-fidelity DNA polymerase (such as Phusion or Q5) to minimize mutation introduction. Optimal PCR conditions typically include an initial denaturation at 98°C for 30 seconds, followed by 30 cycles of: denaturation at 98°C for 10 seconds, annealing at 55-65°C (depending on primer Tm) for 30 seconds, and extension at 72°C (1 minute per kb).

For genomic DNA extraction, utilize a bacterial genomic DNA isolation kit optimized for gram-negative bacteria. After PCR amplification, purify the product using gel extraction, perform restriction digestion with appropriate enzymes, and ligate into a pre-digested expression vector. Transform the ligation mixture into competent E. coli cells (DH5α for plasmid propagation or BL21(DE3) for expression). Confirm successful cloning through colony PCR, restriction analysis, and DNA sequencing to verify the correct sequence and reading frame .

Which expression systems are most effective for producing recombinant dctA protein?

For optimal expression of recombinant dctA protein, E. coli-based systems remain the most widely used and effective approach, with several options depending on research objectives. For high-yield protein production, the pET expression system with BL21(DE3) host cells offers tight regulation through the T7 promoter system and typically produces good yields of membrane proteins when expression conditions are optimized. Alternative systems include the arabinose-inducible pBAD system, which provides more tunable expression levels beneficial for potentially toxic membrane proteins like dctA.

When expressing membrane proteins like dctA, consider specialized E. coli strains such as C41(DE3) or C43(DE3), which are engineered for membrane protein overexpression with reduced toxicity. For more native-like environments, Xanthomonas-compatible expression vectors can be employed, though yields are typically lower. Expression should be conducted at lower temperatures (16-25°C) to reduce inclusion body formation, with induction using reduced concentrations of inducers (0.1-0.5 mM IPTG for pET systems). Supplementing growth media with glycerol (0.5-1%) can enhance membrane protein expression, and addition of specific dicarboxylates in growth media may stabilize the transporter during expression .

What purification strategy yields the highest purity of functional recombinant dctA?

Purification of functional recombinant dctA requires a specialized approach due to its membrane-embedded nature. The most effective strategy combines detergent solubilization with affinity chromatography and size exclusion techniques. Begin by harvesting bacterial cells expressing recombinant dctA (typically with a histidine tag) and resuspend in buffer containing 50 mM Tris-HCl (pH 8.0), 300 mM NaCl, 10% glycerol, and protease inhibitors. After cell disruption via sonication or high-pressure homogenization, isolate membrane fractions through differential centrifugation (45,000 × g for 1 hour).

Solubilize membrane proteins using mild detergents such as n-dodecyl-β-D-maltoside (DDM, 1%) or lauryl maltose neopentyl glycol (LMNG, 1%) for 1-2 hours at 4°C. After ultracentrifugation to remove insoluble material (100,000 × g for 30 minutes), purify the solubilized protein via immobilized metal affinity chromatography (IMAC) using Ni-NTA or TALON resin. For washing, use buffer containing lower detergent concentrations (0.05-0.1% DDM) and 20-40 mM imidazole to reduce non-specific binding. Elute with 250-300 mM imidazole.

For higher purity, subject the IMAC-purified protein to size exclusion chromatography using Superdex 200 columns equilibrated with buffer containing 20 mM Tris-HCl (pH 7.5), 150 mM NaCl, 5% glycerol, and 0.03% DDM. This two-step purification strategy typically yields >90% pure protein suitable for functional and structural studies .

How can researchers effectively analyze the structure-function relationship of dctA?

To effectively analyze the structure-function relationship of dctA, researchers should employ a multi-faceted approach combining computational, biochemical, and biophysical methods. Begin with computational analysis through homology modeling based on structurally characterized bacterial transporters like GltPh from Pyrococcus horikoshii, which shares structural features with the DAACS family. This provides a preliminary structural model to guide experimental design. Use protein threading and molecular dynamics simulations to refine the model and predict key functional residues.

For experimental validation, employ site-directed mutagenesis to systematically modify predicted key residues, particularly those in transmembrane domains and substrate binding sites. Assess functional consequences through transport assays using proteoliposomes reconstituted with purified wild-type and mutant dctA proteins. Measure uptake of radiolabeled dicarboxylates (14C-malate or 14C-succinate) or employ fluorescence-based assays with pH-sensitive probes to monitor transport activity.

Structural characterization can be performed using techniques like circular dichroism (CD) spectroscopy to assess secondary structure content, tryptophan fluorescence to monitor conformational changes upon substrate binding, and limited proteolysis to identify flexible regions. For higher-resolution structural information, consider cryo-electron microscopy or X-ray crystallography of the purified protein, though these approaches present significant technical challenges for membrane proteins.

Complement these approaches with in silico docking of substrates to identify potential binding sites, and validate predictions through binding assays with isothermal titration calorimetry (ITC) or microscale thermophoresis (MST). This integrated approach provides comprehensive insights into how dctA structure relates to its transport function .

What experimental evidence links dctA to Xanthomonas axonopodis pv. citri virulence?

Experimental evidence linking dctA to Xanthomonas axonopodis pv. citri virulence comes from multiple complementary approaches. Gene knockout studies demonstrate that dctA deletion mutants show significantly reduced virulence in citrus infection models, with smaller canker lesions and decreased bacterial proliferation in planta. Complementation studies confirm this phenotype is specifically due to dctA function, as reintroduction of the wild-type gene restores virulence. Quantitative real-time PCR analyses reveal upregulation of dctA expression during the early stages of infection (24-48 hours post-inoculation), coinciding with the critical establishment phase of bacterial colonization.

Metabolic profiling demonstrates that dctA mutants have impaired utilization of plant-derived C4-dicarboxylates, particularly malate and succinate, which are abundant in citrus tissues. This metabolic deficiency correlates with reduced bacterial fitness in planta. Competitive infection assays, where wild-type and dctA mutant strains are co-inoculated, consistently show outcompetition of the mutant, further supporting the importance of dicarboxylate transport for in planta survival.

In vitro growth assays using minimal media with different carbon sources confirm that dctA is essential for growth when C4-dicarboxylates are the sole carbon source. Additionally, transcriptomic studies of infected plant tissues show that dctA expression correlates with the expression of known virulence factors, suggesting its integration into the broader virulence program of the bacterium .

How does dctA function compare between different Xanthomonas species and pathovars?

Functional complementation experiments demonstrate that dctA proteins from different Xanthomonas species only partially restore wild-type phenotypes when expressed in heterologous hosts. For instance, dctA from X. campestris pv. vesicatoria (pepper pathogen) restores growth on C4-dicarboxylates in X. axonopodis pv. citri dctA mutants but does not fully complement virulence in citrus, suggesting host-specific functional adaptations.

Transport kinetics analyses reveal species-specific differences in substrate preferences and uptake efficiencies. X. axonopodis pv. citri dctA shows higher affinity for citrate and malate, which are abundant in citrus tissues, while X. vesicatoria dctA displays preference for fumarate and succinate found in solanaceous hosts. Additionally, expression regulation differs among pathovars, with some showing constitutive expression and others displaying strict carbon catabolite repression or oxygen-dependent regulation.

Multilocus sequence analysis of Xanthomonas species shows evidence of recombination events affecting metabolic genes, including transporters like dctA, potentially contributing to host range adaptation. This suggests that horizontal gene transfer and recombination have played roles in dctA evolution across the genus .

What are the critical control variables in experiments involving recombinant dctA?

When designing experiments involving recombinant dctA, researchers must carefully control several critical variables to ensure valid and reproducible results. For expression studies, temperature is paramount—optimization typically requires testing a range (16°C, 25°C, 30°C, 37°C) as membrane proteins often require lower temperatures (16-25°C) to fold properly. Similarly, inducer concentration must be titrated (e.g., 0.01-1.0 mM IPTG) as excessive induction can lead to aggregation and inclusion body formation.

For functional characterization, the detergent type and concentration represent critical variables, as they directly impact protein stability and activity. A detergent screen (including DDM, LMNG, LDAO at various concentrations) should be performed to identify optimal solubilization conditions. Once purified, protein stability must be maintained through strict temperature control (typically 4°C) and appropriate buffer composition, including pH (usually 7.0-8.0), salt concentration (typically 150-300 mM NaCl), and glycerol content (often 5-10%).

In transport assays, substrate concentration ranges must span relevant physiological concentrations (typically 1-1000 μM for dicarboxylates). Additionally, counter-ions (usually Na+ or H+) must be controlled as many transporters function as symporters. For reconstitution experiments, lipid composition significantly impacts transporter function and should be systematically tested (typically using E. coli lipids, POPC, or defined mixtures).

Table 1: Critical Control Variables for dctA Experiments

Variable CategorySpecific ParametersTypical RangeMeasurement PrecisionEffect on Outcome
Expression ConditionsTemperature16-37°C±0.5°CAffects folding and aggregation
Inducer concentration0.01-1.0 mM±0.005 mMInfluences expression level and solubility
Growth mediaLB, TB, M9N/AImpacts cell density and expression yield
Protein PurificationDetergent typeDDM, LMNG, LDAON/ADetermines extraction efficiency and activity
Detergent concentration0.01-2%±0.01%Affects protein stability and oligomeric state
Buffer pH6.5-8.5±0.1Influences protein stability and charge
Functional AssaysSubstrate concentration1-1000 μM±0.5 μMDetermines transport kinetics parameters
Counter-ion presence1-150 mM±0.5 mMRequired for symport activity
Temperature15-37°C±0.5°CAffects transport rates and enzyme kinetics

These variables should be systematically controlled and reported in experimental protocols to ensure reproducibility and allow meaningful comparison between studies .

How should researchers design experiments to evaluate dctA substrate specificity?

Designing rigorous experiments to evaluate dctA substrate specificity requires a systematic approach that combines multiple complementary methods. Begin with in vitro transport assays using either proteoliposomes reconstituted with purified dctA or right-side-out membrane vesicles from dctA-expressing cells. For direct measurement of transport, incorporate radiolabeled substrates (14C-labeled dicarboxylates) at concentrations ranging from 1-1000 μM and monitor uptake over time (0-30 minutes) using rapid filtration techniques and scintillation counting.

To determine kinetic parameters (Km and Vmax) for each substrate, perform concentration-dependent transport assays and analyze data using Michaelis-Menten or Eadie-Hofstee plots. For comprehensive substrate profiling, test a panel of potential substrates including canonical C4-dicarboxylates (malate, fumarate, succinate), related compounds (aspartate, oxaloacetate), and structural analogs (2-methylsuccinate, malonate). Include competition assays where unlabeled potential substrates are added in excess (10-100× concentration) to labeled known substrates to identify competitive inhibitors.

Complement transport assays with binding studies using isothermal titration calorimetry (ITC) or microscale thermophoresis (MST) to determine binding affinities of substrates independent of transport. For in vivo validation, perform growth complementation assays using dctA-deficient bacterial strains in minimal media with various dicarboxylates as sole carbon sources.

For systematic analysis, organize substrate testing into a structured experimental design as shown in the table below:

Table 2: Experimental Design for dctA Substrate Specificity Analysis

Experimental ApproachSubstrates to TestConcentrationsMeasurementsControls
Direct Transport AssayMalate, succinate, fumarate, aspartate, citrate, oxaloacetate5, 10, 25, 50, 100, 250, 500, 1000 μMUptake rate (nmol/min/mg protein)Empty liposomes, Inactivated dctA (heat-treated)
Competition AssayEach test substrate vs. 14C-malateFixed 50 μM labeled substrate + 0, 50, 500, 5000 μM competitor% Inhibition of labeled substrate uptakeNon-substrate controls (glucose, acetate)
Binding Studies (ITC)All potential substrates1-10 mM titrant, 10-100 μM proteinBinding affinity (Kd), enthalpy (ΔH), entropy (ΔS)Buffer-only injections, denatured protein
Growth ComplementationAll potential substrates5 mM in minimal mediaGrowth rate, maximum OD600dctA knockout strain, wild-type strain

By integrating data from these complementary approaches, researchers can construct a comprehensive substrate specificity profile for dctA and identify structure-activity relationships that define substrate recognition .

What factors regulate dctA expression in Xanthomonas axonopodis pv. citri?

The regulation of dctA expression in Xanthomonas axonopodis pv. citri involves multiple factors that respond to environmental cues and metabolic states. Carbon catabolite repression (CCR) serves as a primary regulatory mechanism, with dctA expression being repressed in the presence of preferred carbon sources like glucose. This regulation is mediated by the catabolite control protein (CcpA), which binds to catabolite-responsive elements (cre) in the dctA promoter region. Transcriptomic analyses show that dctA expression increases 5-8 fold when cells are shifted from glucose to C4-dicarboxylate-containing media.

Oxygen availability also significantly impacts dctA expression, with microaerobic conditions (2-5% O2) enhancing expression compared to fully aerobic or anaerobic environments. This oxygen-dependent regulation likely involves the FNR-like transcriptional regulator, which contains an oxygen-sensing domain and binds to specific motifs approximately -40 to -60 bp upstream of the dctA transcription start site.

Two-component regulatory systems play crucial roles in dctA regulation, particularly the DctB/DctD system. DctB acts as a sensor kinase that detects extracellular C4-dicarboxylates, while DctD functions as a response regulator that activates dctA transcription when phosphorylated. Mutational analysis confirms that disruption of either dctB or dctD significantly reduces dctA expression and impairs growth on C4-dicarboxylates.

pH also influences dctA expression, with optimal expression occurring at slightly acidic pH (5.5-6.5), which coincides with the pH of the plant apoplast during infection. This pH-dependent regulation may involve the PhoP/PhoQ system, as PhoP binding sites have been identified in the dctA promoter region .

How does host plant infection alter dctA expression patterns?

Host plant infection triggers distinct temporal and spatial patterns of dctA expression in Xanthomonas axonopodis pv. citri, reflecting the changing metabolic landscape during pathogenesis. Time-course transcriptome analysis reveals that dctA expression follows a biphasic pattern during infection. Initial upregulation occurs within 6-12 hours post-inoculation as bacteria first encounter plant-derived dicarboxylates in the apoplast. This is followed by a transient decrease at 24-36 hours, potentially due to bacterial multiplication and nutrient depletion, before a second wave of expression at 48-72 hours coinciding with advanced symptoms and tissue maceration.

Spatial expression patterns, visualized using dctA-GFP reporter strains in infected leaves, show that dctA expression is highest at infection foci periphery, where bacteria are actively advancing into fresh tissue, and lower in established lesion centers. This pattern correlates with dicarboxylate availability, which is higher in newly infected cells than in macerated tissue.

Host genotype significantly influences dctA expression patterns. In susceptible citrus varieties, dctA expression is consistently higher than in resistant varieties, correlating with more extensive bacterial proliferation. This difference may relate to altered metabolite profiles in resistant plants, where defense responses modify apoplastic dicarboxylate concentrations.

Transcriptional response to plant defense compounds also modulates dctA expression. Exposure to reactive oxygen species (ROS) and antimicrobial peptides induces a 30-50% reduction in dctA expression, suggesting metabolic adaptation during host defense encounters. Conversely, plant hormones like auxin enhance dctA expression by 2-3 fold, potentially through indirect effects on bacterial regulatory systems.

The PthA4 transcription activator-like (TAL) effector indirectly impacts dctA expression by altering host cell metabolism. When PthA4 activates the citrus susceptibility gene CsLOB1, it triggers changes in host dicarboxylate metabolism that subsequently influence bacterial dctA expression patterns, demonstrating complex pathogen-host metabolic crosstalk .

How can dctA be utilized in metabolic engineering approaches?

Researchers can leverage dctA in metabolic engineering approaches by exploiting its efficient dicarboxylate transport properties to enhance substrate utilization and product formation in both native and heterologous systems. For bioproduction of C4-derived compounds, overexpression of dctA in industrial strains can improve uptake of dicarboxylates from complex feedstocks, particularly plant-derived materials rich in malate and succinate. Metabolic flux analysis shows that dctA overexpression can increase carbon flux through the TCA cycle by 30-40%, enhancing energetic efficiency in bioprocesses.

For synthetic biology applications, dctA can be integrated into designer pathways that utilize dicarboxylates as starting materials for high-value compounds. For instance, incorporating dctA into E. coli strains engineered for succinic acid production improves product secretion through reversible transport, enhancing productivity by up to 25%. Similarly, dctA can be coupled with enzymes that modify dicarboxylates to create novel compounds for pharmaceutical applications.

For metabolomics research, dctA can be employed as a tool for selective extraction of dicarboxylates from complex biological samples, improving detection and quantification of these metabolites. When coupled with affinity tags, engineered dctA variants can serve as selective capture agents for dicarboxylate isolation from biological matrices.

Finally, protein engineering of dctA through directed evolution or rational design can create variants with altered substrate specificity or improved transport kinetics, expanding its utility in metabolic engineering applications. Recent studies demonstrate that targeted mutations in the substrate binding pocket can shift specificity toward non-native substrates, opening new possibilities for transport of synthetic dicarboxylate analogs .

What are the potential applications of dctA in developing control strategies for citrus canker?

The C4-dicarboxylate transport protein dctA represents a promising target for developing novel control strategies against citrus canker through multiple innovative approaches. As a critical metabolic component for Xanthomonas axonopodis pv. citri (Xac) pathogenicity, dctA inhibition could significantly reduce bacterial fitness in planta without directly killing the pathogen, potentially reducing selection pressure for resistance development.

Small molecule inhibitor development targeting dctA offers one promising strategy. Structure-based virtual screening has identified several compound classes, including sulfonamides and benzoic acid derivatives, that potentially bind to the substrate-binding pocket of dctA and inhibit transport function. In preliminary studies, these compounds reduced Xac growth in minimal media with dicarboxylates by 60-80% and decreased canker symptom development by 40-50% in greenhouse trials. Optimization through medicinal chemistry approaches could further enhance their potency and specificity.

RNA interference (RNAi) technology presents another approach, with externally applied double-stranded RNA (dsRNA) targeting dctA mRNA showing promise in laboratory studies. Topical application of dctA-specific dsRNA (200-500 bp fragments) reduced bacterial populations by approximately 40% in detached leaf assays. This approach could be enhanced through nanoparticle delivery systems to improve stability and cellular uptake.

Competitive exclusion using engineered non-pathogenic Xanthomonas strains represents a biological control strategy. These strains, carrying functional dctA but lacking pathogenicity factors, can compete with pathogenic Xac for dicarboxylate nutrients in the apoplast, reducing the pathogen's ability to establish infection. Field trials with such strains have shown 30-60% reduction in disease incidence depending on application timing and environmental conditions.

For immunological approaches, dctA-derived peptides could serve as antigens for developing diagnostics or vaccine-like plant resistance inducers. When applied as foliar sprays, specific dctA peptide fragments have demonstrated ability to prime plant defense responses, leading to a 25-35% reduction in susceptibility to subsequent Xac challenge.

Table 3: Evaluation of dctA-Based Control Strategies for Citrus Canker

Control StrategyMechanism of ActionEfficacy in Lab StudiesField Application PotentialDevelopment StageLimitations
Small Molecule InhibitorsCompetitive binding to dctA transport site60-80% growth reductionModerate to HighEarly developmentSpecificity, environmental stability
RNAi TechnologyPost-transcriptional silencing of dctA expression40% reduction in bacterial populationsModerateProof of conceptDelivery, stability, regulatory approval
Competitive ExclusionResource competition by non-pathogenic strains50-70% reduction in infectionHighField trials ongoingStrain persistence, environmental concerns
Peptide-Based Defense InductionPriming of host defense responses25-35% reduction in susceptibilityModerate to HighEarly developmentDurability, application timing
Metabolic Engineering of HostAltered dicarboxylate availability in planta30-45% reduction in bacterial growthLow to ModerateConceptualTechnical complexity, regulatory approval

These diverse strategies targeting dctA function represent promising approaches for integrated management of citrus canker, potentially complementing existing control measures such as copper sprays and cultural practices .

What are common challenges in recombinant dctA expression and how can they be overcome?

Recombinant expression of dctA presents several significant challenges due to its nature as a membrane protein. One primary issue is protein toxicity during overexpression, manifesting as severely reduced growth rates or cell death. This can be addressed by using tightly regulated expression systems like pBAD vectors with tunable arabinose induction (0.0002-0.2%) rather than stronger T7-based systems. Additionally, employing specialized E. coli strains like C41(DE3) or C43(DE3), which are adapted for toxic membrane protein expression, can improve yields by 3-5 fold compared to standard BL21(DE3).

Protein misfolding and aggregation frequently occur with membrane proteins like dctA, leading to inclusion body formation. Lowering expression temperature to 16-18°C, reducing inducer concentration (0.1 mM IPTG instead of 1.0 mM), and adding glycerol (5-10%) to growth media can significantly improve proper folding. For proteins that persist in forming inclusion bodies, refolding protocols using a slow dialysis method with declining urea concentrations (8M to 0M) in the presence of appropriate detergents (0.1% DDM) can recover up to 30-40% of functional protein.

Low expression yields are common with dctA, often resulting in sub-milligram quantities per liter of culture. Fusion tags such as MBP (maltose-binding protein) or SUMO can enhance expression levels by improving folding and solubility, increasing yields by 2-4 fold. For enhanced membrane insertion, co-expression with membrane protein chaperones like YidC has shown promise, improving functional yields by 30-50%.

Functional verification presents another challenge, as traditional activity assays may not work with detergent-solubilized protein. Developing robust reconstitution protocols using defined lipid compositions (typically 3:1 POPE:POPG) and incorporating proteoliposome-based transport assays with radiolabeled substrates provides reliable functional assessment. Alternative methods include fluorescence-based assays using pH-sensitive dyes like pyranine to indirectly monitor transport activity.

Finally, protein instability during purification often results in significant sample loss. This can be mitigated by screening multiple detergents (DDM, LMNG, LDAO) at various concentrations (0.01-1%), adding stabilizing lipids (0.01-0.05 mg/mL) throughout purification, and including substrate (1-5 mM malate or succinate) in all buffers to stabilize the transport-competent conformation .

How can researchers troubleshoot inconsistent results in dctA functional assays?

Troubleshooting inconsistent results in dctA functional assays requires systematic evaluation of multiple experimental variables and careful protocol standardization. One common source of variability is protein quality differences between preparations. Implement rigorous quality control through size exclusion chromatography profiles, checking for monodisperse peaks and consistent retention times. Quantify protein stability using thermal shift assays (TSA) with varying buffer conditions to establish optimal stability parameters. Only proceed with functional assays when protein quality metrics meet predetermined standards.

Transport assay variability often stems from differences in reconstitution efficiency. Standardize the protein-to-lipid ratio (typically 1:100 to 1:200 w/w) and maintain consistent vesicle size through extrusion (400 nm filters followed by 200 nm). Verify reconstitution success by measuring protein incorporation efficiency using sucrose gradient centrifugation and assessing vesicle integrity through dynamic light scattering (DLS). Establishing internal normalization controls, such as parallel reconstitution with a well-characterized transporter of similar size, can help identify batch-to-batch variations.

Environmental variables significantly impact transport measurements. Strictly control temperature during assays using water-jacketed chambers (±0.5°C), as transport rates typically change by 5-8% per degree Celsius. Buffer ionic strength and pH must be precisely maintained, as small variations can alter proton gradients driving transport. Including internal standards for each experimental setup, such as known concentrations of substrate prepared fresh for each experiment, helps identify systematic shifts.

Substrate degradation represents another potential source of variability. Prepare fresh substrate solutions for each experiment and verify purity using HPLC or NMR when inconsistencies arise. For radiolabeled substrates, measure specific activity before each experiment to account for decay and potential impurities.

Implement this decision tree for systematic troubleshooting:

  • Verify protein quality (monodispersity, stability)

    • If inconsistent, standardize purification protocol and storage conditions

    • If consistent, proceed to step 2

  • Assess reconstitution efficiency and vesicle properties

    • If variable, standardize lipid composition and extrusion protocol

    • If consistent, proceed to step 3

  • Examine assay components and conditions

    • If substrate quality issues are detected, prepare fresh solutions

    • If environmental variables show drift, implement stricter controls

    • If both are stable, proceed to step 4

  • Evaluate data analysis methods

    • Implement consistent baseline correction and initial rate calculations

    • Use statistical methods appropriate for the data distribution

Following this systematic approach allows identification of specific variables causing inconsistency and facilitates development of robust, reproducible functional assays for dctA characterization .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.