Recombinant Xanthomonas axonopodis pv. citri DNA translocase FtsK (ftsK)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Xanthomonas axonopodis pv. citri FtsK

Recombinant Xanthomonas axonopodis pv. citri DNA translocase FtsK (ftsK) is a bacterial protein engineered for research and biotechnological applications. It is derived from Xanthomonas axonopodis pv. citri, a pathogen causing citrus canker disease. The recombinant form is produced in E. coli and includes an N-terminal His tag for purification.

Mechanistic Insights:

  • DNA Translocation: FtsK forms a hexameric ring (α and β subdomains) with a central channel, moving DNA at ~5–7 kb/s .

  • XerCD Interaction: The γ subdomain activates XerCD recombinase at the dif site, resolving chromosome dimers .

3.1. Role in Chromosome Segregation

FtsK coordinates cell division with chromosome unlinking:

  • Translocation Polarity: KOPS motifs dictate unidirectional movement toward the replication terminus (dif site) .

  • XerCD Activation: ATP-dependent translocation ensures topologically unlinked recombination products .

3.2. Recombinant FtsK Production

SpecificationDetail
Expression SystemE. coli with T7 promoter-driven expression
Storage BufferTris/PBS-based buffer, 6% trehalose, pH 8.0
ReconstitutionDeionized sterile water (0.1–1.0 mg/mL), with 50% glycerol for stability

Challenges:

  • Instability: Repeated freeze-thaw cycles degrade activity; storage at -20°C/-80°C is recommended .

Comparative Analysis with E. coli FtsK

While Xanthomonas FtsK shares structural homology with E. coli FtsK, functional studies remain limited. Key contrasts include:

FeatureXanthomonas axonopodis pv. citri FtsKE. coli FtsK
Genome ContextPathogen-specific effector protein Core cell division protein
Translocation Rate~5–7 kb/s (inferred from E. coli studies) ~5–7 kb/s
XerCD InteractionNot experimentally validatedWell-characterized

Experimental Considerations

  • Purification: His-tag enables nickel affinity chromatography .

  • Functional Assays:

    • DNA Translocation: Use fluorescently labeled DNA substrates.

    • XerCD Activation: Monitor Holliday junction formation via gel electrophoresis .

Future Research Directions

  1. Pathogenicity Link: Investigate FtsK's role in Xanthomonas survival or host interaction (e.g., effector protein mimicry) .

  2. Structural Studies: Cryo-EM or X-ray crystallography to resolve domain interactions in Xanthomonas FtsK.

  3. Biotechnological Applications: Explore FtsK as a tool for DNA manipulation in synthetic biology.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its inclusion.
Synonyms
ftsK; XAC2006; DNA translocase FtsK
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-785
Protein Length
full length protein
Species
Xanthomonas axonopodis pv. citri (strain 306)
Target Names
ftsK
Target Protein Sequence
MAKQVPERSSKPAEGKSSSRKTAAADNPRRQKLWRDLALIAVAPLLLYLLASLFTYSATD PGWSRTGNLVAPIHNMGGRFGALAADVLLQLFGYVAFLLPVLLGAVAWIALIGDREEQTQ SDLGPALRLVGMVGFLISSTGFLHLRLFQGEVAEAGGILGKLVAGSLSSRFGALGANLFV LVLLLVSITLATGLSWFAVMERIGKWVLALGPLMQRKTHQATEWQQTRVMREEREEVRKV DAVKQAKREPVKIEPPPAPVVEKSERAKRDTQIPMFQGVSTDGSDLPPLALLDDPKPQTK GYSEETLETLSRQIEFKLKDFRIEAQVVGAYPGPVITRFEIEPAPGIKVSQISSLDKDIA RGLSVKSVRVVDVIPGKSVIGLEIPNVSREMIFLSELLRSKEYDKSASPLTLALGKDIAG RPTVADLARMPHLLVAGTTGSGKSVAVNAMVLSLLFKASHKELRMLMIDPKMLELSVYQG IPHLLAPVVTDMKEAANGLRWCVAEMERRYKLMSAVGVRNLAGFNKKVKDAIDAGQPMMD PLFKPNPELGEAPRPLETLPFIVIFIDEFADMMMIVGKKVEELIARLAQKARAAGIHLIL ATQRPSVDVITGLIKANIPTRVAFQVSSKIDSRTILDQSGAEALLGNGDMLYLPPGTALP DRVHGAFVSDEEVHRVVEHLKASGPVSYVEGVLDEVQTMGDGTVVGATGLPESSGGGGDE SDPLYDEALRIVTETRRASISGVQRRLKIGYNRAARLIEAMEAAGVVSPPEHNGDRTVLA PPPPK
Uniprot No.

Target Background

Function
FtsK, an essential cell division protein, coordinates cell division and chromosome segregation. Its N-terminus is crucial for the assembly of the cell division machinery. The C-terminus functions as an ATP-dependent DNA motor, translocating dsDNA towards the dif recombination site within the replication terminus region. Translocation is precisely halted at Xer-dif sites, where FtsK interacts with Xer recombinase, activating chromosome unlinking through recombination. FtsK orienting polar sequences (KOPS) direct DNA translocation. While FtsK can remove proteins from DNA during translocation, this process specifically stops at the XerCD-dif site, preventing the removal of XerC and XerD from dif.
Database Links

KEGG: xac:XAC2006

STRING: 190486.XAC2006

Protein Families
FtsK/SpoIIIE/SftA family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the full-length recombinant Xanthomonas axonopodis pv. citri DNA translocase FtsK protein?

The recombinant full-length Xanthomonas axonopodis pv. citri DNA translocase FtsK (ftsK) is a protein essential for bacterial cell division, specifically involved in chromosomal DNA segregation during bacterial cytokinesis. The commercially available recombinant protein (Q8PL00) consists of 785 amino acids (full-length 1-785) and is typically expressed in E. coli with an N-terminal His-tag to facilitate purification . The protein functions as a DNA motor that translocates DNA during the late stages of cell division to ensure proper chromosome segregation.

How does FtsK contribute to bacterial pathogenicity in Xanthomonas?

Comparative genomic studies of Xanthomonas species have revealed that cell division proteins like FtsK are part of the core genome necessary for bacterial survival and virulence . Unlike some of the specialized virulence factors such as the plant natriuretic peptide-like protein (XacPNP) that directly modulate host responses , FtsK's contribution to pathogenicity is likely through its fundamental role in maintaining bacterial viability and population growth during infection.

What are the optimal conditions for reconstitution and storage of purified recombinant XacFtsK?

For optimal handling of recombinant XacFtsK:

  • Reconstitution: The lyophilized protein should be briefly centrifuged prior to opening. Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL .

  • Storage preparation: Add glycerol to a final concentration of 5-50% and aliquot for long-term storage .

  • Storage conditions: Store at -20°C/-80°C. Repeated freezing and thawing is not recommended. Working aliquots can be stored at 4°C for up to one week .

  • Buffer conditions: The recombinant protein is typically supplied in Tris/PBS-based buffer containing 6% Trehalose, pH 8.0 .

Storage ParameterRecommended Condition
Long-term storage-20°C/-80°C with 5-50% glycerol
Working storage4°C (up to one week)
Buffer compositionTris/PBS-based, 6% Trehalose, pH 8.0
AliquotingRequired to avoid freeze-thaw cycles

How can I assess the DNA translocation activity of purified XacFtsK?

Assessment of DNA translocation activity of FtsK requires specialized assays that measure its ability to move DNA in an ATP-dependent manner. Based on methodologies used for similar bacterial DNA translocases, including those from other Xanthomonas species, the following approaches are recommended:

  • In vitro DNA translocation assays: Using fluorescently labeled DNA substrates and measuring the displacement of these substrates over time using fluorescence microscopy or FRET-based approaches.

  • ATPase activity assays: Since DNA translocation is coupled to ATP hydrolysis, measuring the ATPase activity of XacFtsK in the presence and absence of DNA substrates can provide indirect evidence of translocation capacity.

  • Single-molecule techniques: Optical or magnetic tweezers can be used to directly observe and quantify FtsK-mediated DNA movement at the single-molecule level.

When designing these experiments, it's important to note that FtsK typically requires specific DNA sequences (KOPS - FtsK-orienting polar sequences) for directional translocation. For Xanthomonas FtsK, identification of bacterial-specific consensus sequences may be necessary for optimal activity assessment.

How does XacFtsK compare with FtsZ in Xanthomonas axonopodis pv. citri?

While both FtsK and FtsZ are essential cell division proteins in Xanthomonas, they serve different functions within the divisome complex:

FeatureFtsK (DNA Translocase)FtsZ
FunctionDNA segregation during late cell divisionInitial Z-ring formation, bacterial cytoskeleton
Enzymatic activityDNA-dependent ATPaseGTPase activity
StructureMulti-domain with N-terminal membrane anchor and C-terminal motor domainTubulin-like with GTPase domain
Inhibition by alkyl gallatesNot specifically documentedLess susceptible than B. subtilis FtsZ
Role in drug targetingPotential but less exploredEstablished target for antimicrobials

Research on Xanthomonas FtsZ has shown that this protein can be purified in its native form and characterized for GTP hydrolysis and polymerization properties . Similar approaches could be applied to XacFtsK, though the assays would focus on ATPase activity rather than GTPase activity.

What genomic context surrounds the ftsK gene in Xanthomonas axonopodis pv. citri?

Comparative genomic analysis of Xanthomonas strains reveals that the ftsK gene is part of the core genome maintained across different pathovars. In X. axonopodis pv. citri, like in other bacteria, the ftsK gene is typically located within a gene cluster involved in cell division and chromosome maintenance.

The genome of X. axonopodis pv. citri is approximately 4.9 Mb in size . Unlike some other citrus Xanthomonas pathogens, certain strains lack plasmids, which affects the organization of their genetic material. When analyzing the genomic context of ftsK, it's important to note that cell division genes in Xanthomonas can differ significantly from those in model organisms like E. coli, particularly in terms of regulatory elements and genetic organization.

Genes encoding other cell division proteins, DNA repair enzymes, and chromosomal maintenance factors are frequently found in proximity to ftsK, reflecting their coordinated functions during the bacterial cell cycle.

How can I generate and validate FtsK knockout mutants in Xanthomonas axonopodis pv. citri?

Generating FtsK knockout mutants in Xanthomonas requires careful consideration since FtsK is potentially essential for bacterial viability. Based on approaches used for other Xanthomonas proteins, the following methodology is recommended:

  • Conditional knockout approach: Rather than complete deletion, consider creating conditional mutants using inducible promoters to control FtsK expression.

  • Marker exchange mutagenesis: This method has been successfully used to create knockout mutants in X. axonopodis pv. citri for proteins like XacPNP . The technique involves:

    • Constructing a plasmid containing antibiotic resistance cassettes flanked by sequences homologous to regions upstream and downstream of the ftsK gene

    • Introducing this plasmid into X. axonopodis pv. citri through electroporation or conjugation

    • Selecting for double recombinants using appropriate antibiotics

  • Verification methods:

    • PCR verification using primers flanking the deletion region

    • Western blot analysis using antibodies against FtsK

    • Phenotypic analysis focusing on cell morphology, division defects, and DNA content

  • Complementation studies: Reintroducing the wild-type ftsK gene on a plasmid (such as pBBR1MCS-5, which has been successfully used in Xanthomonas ) to confirm that observed phenotypes are specifically due to the absence of FtsK.

What role might FtsK play in Xanthomonas stress responses and virulence regulation?

While direct evidence linking FtsK to stress responses in Xanthomonas is limited, research on other proteins in this pathogen provides context for potential regulatory connections:

  • Light-responsive regulation: Studies have shown that Xanthomonas contains photoreceptors like LOV proteins that modulate bacterial motility, exopolysaccharide production, biofilm formation, and virulence . Like these sensory systems, FtsK activity might be modulated in response to environmental conditions during plant infection.

  • Stress adaptation: During plant infection, Xanthomonas faces various stresses including nutrient limitation, plant defense responses, and oxidative stress. FtsK-mediated chromosome segregation may be particularly important during stress-induced changes in cell division rates.

  • Connection to virulence pathways: Xanthomonas pathogenicity involves coordinated expression of virulence factors. The cell division machinery, including FtsK, likely interfaces with these virulence networks, particularly during the rapid proliferation phases required for successful infection.

Research on other Xanthomonas proteins has demonstrated that seemingly housekeeping functions can play unexpected roles in virulence. For example, the XacPNP protein, which shares sequence similarity with plant natriuretic peptides, helps modulate host responses to favor bacterial survival . Similar studies examining FtsK function under infection-like conditions could reveal unexpected roles in pathogenicity.

How does temperature affect XacFtsK activity, and what implications does this have for experimental design?

Temperature is a critical factor affecting both the stability and activity of XacFtsK. Based on research with related proteins:

  • Experimental temperatures: For in vitro studies with purified XacFtsK, temperatures between 25-30°C likely represent a good compromise between protein stability and activity, reflecting the natural growth temperature range of Xanthomonas.

  • Temperature effects on ATPase activity: As an ATPase, XacFtsK activity typically increases with temperature up to an optimal point, after which thermal denaturation causes activity loss. Preliminary temperature optimization is recommended for enzymatic assays.

  • Pathogenicity considerations: Since Xanthomonas infections occur in plants under varying environmental temperatures, studying FtsK function across a temperature range (20-35°C) may provide insights into how cell division adapts during infection under different conditions.

  • Storage implications: While the recombinant protein should be stored at -20°C/-80°C for long-term preservation , working with the protein at ambient or physiological temperatures during experiments requires careful monitoring of protein stability.

What protein interaction partners of FtsK would be valuable to investigate in Xanthomonas?

Identifying FtsK interaction partners in Xanthomonas would provide valuable insights into its regulatory network and cell division mechanisms. Based on knowledge from model bacteria and Xanthomonas research, the following interactions merit investigation:

  • Divisome components: Other cell division proteins like FtsZ, which has been characterized in Xanthomonas , likely interact with FtsK during divisome assembly.

  • DNA-binding proteins: Nucleoid-associated proteins and chromosome organization factors potentially coordinate with FtsK during chromosome segregation.

  • Regulatory proteins: Proteins involved in stress responses and virulence regulation may interact with FtsK to coordinate cell division with the infection process.

  • Methodology for interaction studies:

    • Co-immunoprecipitation using anti-His antibodies against the recombinant His-tagged FtsK

    • Bacterial two-hybrid assays

    • Proximity-based labeling approaches

    • Pull-down assays using the purified recombinant protein as bait

Investigating these interactions may reveal species-specific adaptations of the cell division machinery in Xanthomonas that could potentially serve as targets for novel antibacterial strategies against citrus canker disease.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.