Recombinant Xanthomonas axonopodis pv. citri Glucans biosynthesis glucosyltransferase H (opgH)

Shipped with Ice Packs
In Stock

Description

Enzymatic Mechanism and Role in OPG Biosynthesis

Opgh collaborates with the periplasmic protein OpgG to synthesize branched OPGs:

  • Primary Activity: Catalyzes the formation of β-1,2-linked glucose backbones from UDP-glucose .

  • Branching: OpgG introduces β-1,6-linked side chains to the backbone .

  • Subcellular Role: Localizes to the inner membrane, with its transmembrane segments facilitating glucan export to the periplasm .

Key Research Findings:

  • Substrate Dependency: Requires acyl carrier protein (ACP) as a cofactor for in vitro activity .

  • UDP-Glucose Regulation: Intracellular UDP-glucose levels influence Opgh’s enzymatic activity and its moonlighting role in cell division regulation .

Role in Bacterial Pathogenicity

In Xanthomonas axonopodis pv. citri (Xac), Opgh contributes to virulence through:

  • Host Interaction: Facilitates biofilm formation, motility, and evasion of plant immune responses .

  • Stress Adaptation: OPGs buffer against osmotic fluctuations during host colonization .

Pathogenicity Studies:

  • Mutant Phenotypes: opgH deletion in Xac reduces survival under osmotic stress and attenuates citrus canker symptoms .

  • Host Defense Modulation: OPGs suppress plant immune responses by interfering with pathogen-associated molecular pattern (PAMP) recognition .

Moonlighting Functions in Cell Division

Opgh exhibits a secondary role in bacterial cell cycle regulation:

  • FtsZ Interaction: Binds to the tubulin-like protein FtsZ in E. coli, delaying divisome assembly and increasing cell size under nutrient-rich conditions .

  • Growth Rate Dependency: Localizes to the division site in fast-growing cells, linking metabolic state to morphogenesis .

Table 2: Functional Analogues Across Species

OrganismHomologPrimary RoleMoonlighting Function
E. coliOpghOPG biosynthesisFtsZ inhibition, cell size control
Caulobacter crescentusOpghEssential for morphologyRegulates peptidoglycan synthesis
Bacillus subtilisUgtPTeichoic acid synthesisFtsZ inhibition

Biotechnological and Research Applications

  • Enzyme Characterization: Used to study glucosyltransferase mechanisms and OPG biosynthesis .

  • Pathogenesis Models: Recombinant Opgh aids in dissecting virulence pathways in Xac .

  • Agricultural Targets: Potential candidate for developing anti-biofilm agents to control citrus canker .

Challenges and Future Directions

  • Structural Insights: No crystal structure of Xac Opgh exists; homology modeling relies on E. coli Opgh .

  • Functional Redundancy: Overlap with OpgG complicates in vivo studies of glucan branching .

  • Therapeutic Potential: Targeting Opgh’s glucosyltransferase activity could disrupt biofilm formation without affecting host plants .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it when placing your order, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please contact your local distributor for specific delivery details.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please communicate with us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure all contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type will be decided during production. If you have a preferred tag type, please inform us, and we will prioritize developing the specified tag.
Synonyms
opgH; hrpM; XAC0618; Glucans biosynthesis glucosyltransferase H
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-645
Protein Length
full length protein
Species
Xanthomonas axonopodis pv. citri (strain 306)
Target Names
opgH
Target Protein Sequence
MDGTVTPSPITTAMPPVSALDAGTPTLPPEAPLAMPEQNLREGSLQVRHQRTSPPGIGVR RFYLIGGTFATTAIAVWVMLSVLWPDGISVLEGCLLGLFVLLFAWIAMSFASAVAGFVTV VARAGRKLGIDPEQPLPTLRSRTALLMPTYNEDPRRLLAGLQAIYESVAETGQLEHFDFF VLSDTTREHIGRAEELVYNALCDRVGGHGRIFYRRRADNAARKAGNVADWVRRFGGSYPQ MLILDADSVMTGDTIVRLVAGMENNPDVGLIQTLPAVVNGQTLFARMQQFGGRVYGPIIA FGVAWWHGAESNYWGHNAIIRTQAFADHAGLPSLRGRKPFGGHVLSHDFVEAALMRRGGW AMHMVPYLQGSYEEGPPTLTDLLIRDRRWCQGNLQHAKVVGAKGLHWISRMHMLIGIGHY FTAPMWGLLMLIGIGIPLAGGDIDLAGDLPFSPARYWHGSSQGNAIWIFVCTMFVLLAPK LLGYIALLLNPRELRACGGAFRAAVSILLETVLAALMAPVVMYLQSRGVFEVLAGKDSGW DAQVRDDGKLSWPALLRSYGGLTVFGLFMGAVAYAVSPALAAWMGPVIVGMALSIPVVAL TSLRRTGMALRRAGIFCIPEELDPPKVLVRASELRRAAALEPSLI
Uniprot No.

Target Background

Function
Plays a role in the biosynthesis of osmoregulated periplasmic glucans (OPGs).
Database Links

KEGG: xac:XAC0618

STRING: 190486.XAC0618

Protein Families
Glycosyltransferase 2 family, OpgH subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the role of opgH in Xanthomonas axonopodis pv. citri pathogenicity?

OpgH is a glucosyltransferase involved in glucan biosynthesis that contributes significantly to Xanthomonas pathogenicity. Similar to other glycosyltransferases in Xanthomonas species, opgH likely plays a critical role in synthesizing extracellular polysaccharides (EPS) and lipopolysaccharides (LPS), which are essential virulence factors . Studies with related glycosyltransferases, such as gpsX, have demonstrated that mutations in these genes result in reduced EPS production, altered LPS profiles, impaired biofilm formation, and attenuated virulence in citrus plants . The opgH protein likely contributes to bacterial survival under various environmental stresses, including oxidative stress conditions encountered during host infection .

How does the structure of opgH compare to other glycosyltransferases in Xanthomonas species?

While specific structural information for Xac opgH is not fully characterized, it shares sequence homology with other bacterial glycosyltransferases. Glycosyltransferases like opgH typically contain conserved catalytic domains responsible for the transfer of sugar moieties to various acceptor molecules. Based on related proteins, opgH likely possesses transmembrane domains that anchor it to the cell membrane, with catalytic regions extending into the cytoplasm . Comparative genomic analyses of Xanthomonas strains have revealed that glycosyltransferases are among the pathogenicity-related genes with variable presence or pseudogenization across different pathovars, suggesting evolutionary adaptation to specific hosts .

What expression systems have been successfully used for recombinant production of Xanthomonas proteins?

Several expression systems have proven effective for recombinant production of Xanthomonas proteins. For example:

  • Escherichia coli expression systems: Similar to the approach used for Rhodopseudomonas palustris opgH, E. coli has been successfully employed for expressing recombinant Xanthomonas proteins with N-terminal His-tags for purification .

  • Pichia pastoris expression system: This yeast expression system has been used for successful recombinant expression of Xanthomonas enzymes, including a cysteine peptidase from Xac strain 306, yielding approximately 10 mg/L of purified protein .

The choice of expression system depends on protein characteristics, required modifications, and downstream applications. For membrane-associated proteins like opgH, E. coli expression systems with appropriate solubilization strategies or cell-free expression systems may be particularly suitable.

What are the optimal conditions for expressing and purifying recombinant Xac opgH protein?

Based on related glycosyltransferase expression protocols, optimal conditions for expressing and purifying recombinant Xac opgH would include:

Expression:

  • Vector selection: pET-based vectors with inducible promoters allow controlled expression

  • E. coli strain: BL21(DE3) or derivatives optimized for membrane protein expression

  • Induction conditions: 0.1-0.5 mM IPTG at 16-20°C for 16-20 hours to minimize inclusion body formation

  • Culture media: Enriched media (e.g., Terrific Broth) supplemented with appropriate antibiotics

Purification:

  • Solubilization: Mild detergents (DDM, LDAO) for membrane extraction

  • IMAC purification: Using Ni-NTA resin for His-tagged protein capture

  • Buffer composition: Tris/PBS-based buffer containing 6% trehalose at pH 8.0 for stability

  • Storage: Aliquot and store at -80°C with 50% glycerol to prevent freeze-thaw damage

For downstream functional assays, reconstitution of purified opgH into liposomes may be necessary to maintain enzymatic activity.

How can the enzymatic activity of recombinant opgH be assessed in vitro?

The enzymatic activity of recombinant opgH can be assessed through multiple complementary approaches:

Radiometric assay:

  • Incubate purified opgH with radiolabeled UDP-glucose (substrate) and acceptor molecules

  • Quantify incorporation of radiolabeled glucose into glucan products via liquid scintillation counting

HPLC/MS analysis:

  • Monitor the conversion of UDP-glucose to UDP and glucan products

  • Analyze product formation using HPLC coupled with mass spectrometry

Colorimetric coupled-enzyme assay:

  • Link UDP production to NADH oxidation through pyruvate kinase and lactate dehydrogenase

  • Monitor decrease in NADH absorption at 340 nm

Recommended assay conditions:

  • Buffer: 50 mM HEPES, pH 7.5, 10 mM MgCl₂

  • Temperature: 25-30°C

  • UDP-glucose concentration: 0.1-1 mM

  • Acceptor molecules: Various oligosaccharides or lipid-linked intermediates

Kinetic parameters (K<sub>m</sub>, V<sub>max</sub>) should be determined for both UDP-glucose and acceptor molecules to fully characterize enzymatic properties.

What approaches can be used to generate and characterize opgH mutants in Xanthomonas axonopodis pv. citri?

Several approaches can be employed to generate and characterize opgH mutants:

Generation of opgH mutants:

  • Homologous recombination:

    • Design knockout constructs with antibiotic resistance cassettes flanked by opgH homology regions

    • Transform Xac cells with linear or suicide plasmid constructs

    • Select transformants on appropriate antibiotic media

  • CRISPR-Cas9 genome editing:

    • Design sgRNAs targeting opgH

    • Co-deliver Cas9, sgRNA, and repair template

    • Screen for successful editing through PCR and sequencing

Characterization methodologies:

  • Phenotypic analysis:

    • Growth curves: Monitor bacterial growth rates in rich and minimal media

    • Stress resistance: Test survival under oxidative stress (H₂O₂ exposure)

    • Biofilm formation: Quantify using crystal violet staining on abiotic surfaces

    • EPS production: Measure using precipitation and colorimetric methods

  • Virulence assessment:

    • Plant infection assays: Inoculate citrus leaves with wild-type and mutant strains

    • Symptom development: Monitor and quantify canker formation over time

    • Bacterial colonization: Determine bacterial populations in infected tissues

  • Complementation studies:

    • Reintroduce wild-type or mutated opgH variants into knockout strains

    • Assess restoration of phenotypes to confirm gene function

This systematic approach would provide comprehensive insights into opgH function in Xac pathogenesis.

How does opgH contribute to biofilm formation in Xanthomonas axonopodis pv. citri?

OpgH likely plays a critical role in biofilm formation through its involvement in glucan synthesis. Studies with related glycosyltransferases in Xanthomonas have shown:

  • EPS contribution: Glycosyltransferases synthesize extracellular polysaccharides that form the biofilm matrix, providing structural integrity and protection .

  • Adhesion properties: Glucans produced by opgH may facilitate initial attachment to surfaces and cell-cell aggregation during biofilm development.

  • Surface properties regulation: The opgH protein likely influences cell surface hydrophobicity and charge, affecting bacterial aggregation and adhesion to surfaces.

Experimental data with similar glycosyltransferase mutants (gpsX) showed significantly reduced biofilm formation on both abiotic surfaces and plant tissues . Quantitative biofilm assays comparing wild-type Xanthomonas strains with various pathovars showed differential biofilm production capacities, with strains like XauC 535 exhibiting high biofilm production in virulence-inducing medium (XVM2) .

The table below summarizes comparative biofilm formation and associated phenotypes observed in Xanthomonas strains:

StrainBiofilm FormationXanthan ProductionSelf-Aggregation
X. citri A306ModerateHighLow
XauC 535HighModerateModerate
XauC 1609ModerateLowHigh
Glycosyltransferase mutantsSignificantly reducedReducedReduced

These observations support the critical role of glycosyltransferases like opgH in biofilm-related phenotypes, which are essential for successful host colonization and pathogenesis .

What is the relationship between opgH activity and Xanthomonas virulence in citrus canker disease?

The relationship between opgH activity and Xanthomonas virulence in citrus canker is likely multifaceted:

  • Host colonization: OpgH-synthesized glucans facilitate bacterial attachment to host surfaces and formation of microcolonies, essential first steps in infection .

  • Stress protection: Glucans contribute to bacterial survival under oxidative and osmotic stresses encountered during host infection. Glycosyltransferase mutants show increased sensitivity to H₂O₂ oxidative stress .

  • Immune evasion: Surface polysaccharides can mask bacterial pathogen-associated molecular patterns (PAMPs), helping evade plant immune recognition.

  • Nutrient acquisition: Biofilms facilitated by opgH-produced glucans create microenvironments that enhance nutrient acquisition from host tissues.

  • Type III secretion system interaction: While opgH primarily affects EPS/LPS production, these surface components coordinate with Type III secretion systems to deliver effector proteins into host cells .

Phylogenomic analyses have revealed that glycosyltransferase genes show variable presence/absence patterns across Xanthomonas strains with different host ranges and virulence capabilities . The citrus canker-causing Xanthomonas strains can be separated into two distinct clades: the Citri-citri clade (containing A strains) and the aurantifolii clade (containing B and C strains), suggesting evolutionary adaptations in pathogenicity-related genes including glycosyltransferases .

How do structural modifications of opgH-synthesized glucans affect bacterial adaptation to different environmental conditions?

Structural modifications of opgH-synthesized glucans significantly impact bacterial adaptation to various environmental conditions:

  • Temperature fluctuations: Modified glucan structures can maintain membrane fluidity and integrity across temperature ranges encountered during infection cycles.

  • pH adaptation: The degree of branching and substitution patterns in glucans may change in response to pH, helping bacteria adapt to acidic plant apoplast or alkaline leaf surfaces.

  • Desiccation resistance: Highly hydrated glucan matrices protect bacteria during dry conditions on leaf surfaces by maintaining a hydrated microenvironment.

  • Ion homeostasis: Charged modifications on glucans (like pyruvylation or acetylation) affect ion binding, helping maintain electrolyte balance under varying ionic conditions.

Research indicates that Xanthomonas strains modulate their surface polysaccharide composition in response to environmental cues, particularly in virulence-inducing conditions . For example, XauC strains exhibit different patterns of self-aggregation and biofilm formation compared to X. citri pv. citri strains when grown in virulence-inducing medium (XVM2) , suggesting dynamic regulation of glucan synthesis enzymes like opgH.

How conserved is the opgH gene across different Xanthomonas pathovars and what does this suggest about its evolutionary importance?

Genomic analyses reveal interesting patterns of conservation for glycosyltransferases across Xanthomonas pathovars:

  • Conservation patterns: Phylogenomic analyses of 31 Xanthomonas citri strains show that certain pathogenicity-related genes, including those involved in surface structure biosynthesis like glycosyltransferases, exhibit variable presence/absence across lineages .

  • Evolutionary implications: The variable conservation suggests that glycosyltransferases like opgH have undergone selective pressure during host adaptation processes.

  • Clade-specific patterns: Two distinct and well-supported major clades have been identified: the Xanthomonas citri pv. citri clade and the XauB and XauC clade . The distribution of glycosyltransferases between these clades reflects their evolutionary history and host adaptation.

  • Host range correlation: Interestingly, strains pathogenic in taxonomically disparate plant hosts (citrus, leguminosae, cashew, mango, and cotton) show different patterns of glycosyltransferase gene conservation, suggesting these enzymes contribute to host specificity .

The conservation of opgH and related glycosyltransferases likely reflects their fundamental roles in bacterial physiology while variations may represent adaptations to specific host environments or virulence strategies.

What insights can comparative analyses of opgH provide about the evolution of pathogenicity in Xanthomonas species?

Comparative analyses of opgH and related glycosyltransferases provide several insights into pathogenicity evolution:

  • Horizontal gene transfer: The distribution patterns of glycosyltransferases suggest potential horizontal acquisition events that may have contributed to host range expansion.

  • Host jump events: Phylogenetic analyses reveal curious evolutionary patterns, such as X. citri pv. anacardii (infecting cashew) apparently evolving within a citrus-associated clade, suggesting possible host jumps mediated by changes in surface polysaccharides .

  • Co-evolution with secretion systems: Comparative analysis of secretion-system and surface-structure genes showed that XauB and XauC genomes lack several key genes in pathogenicity-related subsystems compared to the more aggressive X. citri pv. citri strains . This suggests co-evolution of glycosyltransferases with other virulence factors.

  • Pseudogenization: Some glycosyltransferase genes show evidence of pseudogenization in certain lineages, representing potential evolutionary "experiments" in pathogenicity .

These observations collectively suggest that glycosyltransferases like opgH have been important players in the evolutionary arms race between Xanthomonas pathogens and their plant hosts, with modifications in these genes potentially facilitating host range expansions or changes in virulence strategies.

What are common challenges in recombinant expression of opgH and strategies to overcome them?

Recombinant expression of opgH presents several challenges due to its membrane association and complex activity. Common issues and solutions include:

Challenge 1: Poor expression levels

  • Strategy: Optimize codon usage for expression host

  • Strategy: Test multiple promoter strengths and induction conditions

  • Strategy: Use specialized E. coli strains (e.g., C41/C43) designed for membrane protein expression

  • Strategy: Consider fusion tags that enhance solubility (MBP, SUMO) alongside the His-tag for purification

Challenge 2: Protein misfolding and aggregation

  • Strategy: Lower induction temperature (16-20°C)

  • Strategy: Add chemical chaperones to culture medium (e.g., glycerol, trehalose)

  • Strategy: Co-express with molecular chaperones (GroEL/ES, DnaK)

  • Strategy: Use gentle detergents for solubilization during purification

Challenge 3: Loss of activity during purification

  • Strategy: Include stabilizing agents (glycerol, trehalose) in all buffers

  • Strategy: Minimize exposure to freeze-thaw cycles by creating working aliquots

  • Strategy: Consider purification under anaerobic conditions if oxidation is an issue

  • Strategy: Reconstitute into lipid nanodiscs or liposomes to maintain native-like membrane environment

Challenge 4: Heterogeneous glycosylation

  • Strategy: Perform enzymatic deglycosylation if glycosylation interferes with activity assessment

  • Strategy: Consider expression in glycosylation-deficient strains if appropriate

Applying these strategies systematically can significantly improve the yield and activity of recombinant opgH protein.

How can opgH function be studied in the context of host-pathogen interactions?

Studying opgH function in host-pathogen interactions requires integrated approaches:

1. In planta infection models:

  • Citrus leaf infiltration: Inoculate wild-type and opgH mutant strains into citrus leaves and monitor symptom development

  • Detached leaf assays: Quantify bacterial growth, biofilm formation, and tissue maceration

  • Whole plant studies: Assess systemic spread and long-term disease progression

2. Microscopy techniques:

  • Confocal microscopy: Track GFP-labeled bacteria during infection process

  • Electron microscopy: Visualize bacterial surface structures and host-pathogen interfaces

  • FRET-based approaches: Monitor enzyme-substrate interactions in situ

3. Transcriptomic analyses:

  • RNA-seq: Compare host and pathogen transcriptomes during infection with wild-type vs. opgH mutants

  • RT-qPCR: Validate expression changes of key virulence genes like pthA

4. Metabolomic approaches:

  • Mass spectrometry: Profile changes in cell wall-related metabolites

  • Isotope labeling: Track incorporation of labeled precursors into bacterial glucans during infection

5. Immune response assessment:

  • ROS measurement: Quantify reactive oxygen species production during infection

  • Defense gene expression: Monitor plant defense gene induction

  • Callose deposition: Assess plant cell wall reinforcement responses

These multidisciplinary approaches provide comprehensive insights into opgH function during infection and host response mechanisms.

What controls should be included when assessing the impact of opgH mutations on Xanthomonas phenotypes?

Robust experimental design for assessing opgH mutation impacts requires comprehensive controls:

Genetic controls:

  • Wild-type strain: Parental strain with intact opgH gene

  • Complemented mutant: opgH mutant transformed with wild-type opgH gene to verify phenotype restoration

  • Vector control: opgH mutant with empty vector to control for vector effects

  • Point mutant control: opgH with catalytic site mutations to distinguish enzymatic vs. structural roles

Phenotypic control assays:

  • Growth curves in non-selective media: Ensure mutations don't cause general growth defects

  • Motility assays: Assess whether observed phenotypes are due to motility impairment rather than direct opgH effects

  • Multiple stress conditions: Test under various stresses to distinguish specific vs. general stress responses

  • Parallel mutation analysis: Compare with mutations in other glycosyltransferases (e.g., gpsX) to identify functional overlap or specificity

Technical controls:

  • Multiple biological replicates: Minimum three independent mutant isolates

  • Multiple technical replicates: At least three replicates per experiment

  • Time-course measurements: Capture dynamic rather than endpoint phenotypes

  • Host variety controls: Test multiple citrus varieties to ensure consistent phenotypes across hosts

Statistical analysis:

  • Apply appropriate statistical tests (ANOVA with post-hoc tests) to determine significance

  • Include power calculations to ensure adequate sample sizes

  • Control for multiple comparisons when assessing multiple phenotypes

These comprehensive controls ensure that phenotypes can be reliably attributed to opgH function rather than secondary effects.

How might opgH be targeted for novel antimicrobial development against citrus canker disease?

OpgH represents a promising target for novel antimicrobial development through several strategies:

  • Small molecule inhibitors:

    • Structure-based drug design targeting the catalytic site of opgH

    • High-throughput screening of chemical libraries for compounds that inhibit glucosyltransferase activity

    • Rational modification of natural substrate analogs to create competitive inhibitors

  • Peptide-based approaches:

    • Design of antimicrobial peptides that interfere with opgH membrane localization

    • Development of peptides that mimic protein-protein interaction interfaces

  • RNA-based strategies:

    • Design of antisense oligonucleotides targeting opgH mRNA

    • Development of external guide sequences for RNase P-mediated degradation of opgH transcripts

  • Immunological approaches:

    • Development of antibodies targeting surface-exposed opgH epitopes

    • Engineering of plant immune receptors to recognize opgH-dependent pathogen signatures

  • Combination strategies:

    • Synergistic targeting of opgH with inhibitors of other virulence factors

    • Co-application with compounds that enhance plant immune responses

Given that glycosyltransferases like opgH are absent in plants but essential for bacterial pathogenicity, they represent selective targets with potentially minimal off-target effects on host physiology or beneficial microbiota.

What emerging technologies could advance our understanding of opgH structure-function relationships?

Several cutting-edge technologies hold promise for deepening our understanding of opgH:

  • Cryo-electron microscopy (Cryo-EM):

    • Near-atomic resolution structures of membrane-embedded opgH

    • Visualization of conformational changes during catalytic cycle

    • Complex structures with substrates and interaction partners

  • AlphaFold and machine learning approaches:

    • Accurate structural predictions of opgH domains and complexes

    • Identification of critical residues and interaction interfaces

    • Virtual screening of potential inhibitors

  • Single-molecule techniques:

    • FRET-based approaches to monitor conformational dynamics during catalysis

    • Optical tweezers to measure force generation during polysaccharide synthesis

    • Super-resolution microscopy to visualize opgH localization and dynamics in living cells

  • Nanoscale biophysical methods:

    • Atomic force microscopy to probe membrane topology and mechanical properties

    • Surface plasmon resonance for real-time interaction kinetics

    • Hydrogen-deuterium exchange mass spectrometry to map conformational changes

  • Synthetic biology approaches:

    • Designer opgH variants with altered specificity or regulation

    • Reconstitution of minimal synthetic systems for glucan synthesis

    • CRISPR interference for precise temporal control of opgH expression

These technologies, especially when applied in combination, could revolutionize our understanding of how opgH structure dictates function in bacterial pathogenesis.

How can systems biology approaches integrate opgH function into broader pathogenicity networks in Xanthomonas?

Systems biology offers powerful frameworks to contextualize opgH within broader pathogenicity networks:

  • Multi-omics integration:

    • Combine transcriptomics, proteomics, and metabolomics data from wild-type and opgH mutants

    • Identify compensatory mechanisms activated upon opgH disruption

    • Map the impact of environmental conditions on opgH-dependent networks

  • Protein-protein interaction mapping:

    • Affinity purification-mass spectrometry to identify opgH interaction partners

    • Bacterial two-hybrid screens for systematic interaction mapping

    • In vivo crosslinking to capture transient interactions during infection

  • Regulatory network analysis:

    • ChIP-seq to identify transcription factors regulating opgH

    • RNA-seq under various conditions to place opgH in condition-specific regulons

    • Network motif analysis to identify feed-forward and feedback loops involving opgH

  • Flux balance analysis:

    • Metabolic modeling to predict the impact of opgH activity on cellular metabolism

    • Constraint-based modeling to identify essential partners in glucan biosynthesis

    • Simulation of metabolic adaptations under various infection conditions

  • Comparative systems biology:

    • Cross-species comparison of glycosyltransferase networks

    • Evolutionary analysis of opgH co-option into different virulence strategies

    • Host-pathogen interface modeling

Phylogenomic analyses have already positioned glycosyltransferases within broader evolutionary patterns in Xanthomonas species . Further systems-level integration would reveal how opgH coordinates with other pathogenicity subsystems, potentially identifying vulnerable network nodes for targeted intervention strategies against citrus canker disease.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.