Recombinant Xanthomonas axonopodis pv. citri Lipid A export ATP-binding/permease protein MsbA (msbA)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant MsbA Protein

Recombinant MsbA is a full-length (1–589 amino acids) ATP-binding cassette (ABC) transporter protein expressed in E. coli with an N-terminal His tag. It is derived from Xanthomonas axonopodis pv. citri, a plant pathogen causing citrus canker .

Pathogenicity Studies

  • MsbA is essential for X. axonopodis virulence, as LPS contributes to bacterial evasion of plant immune responses .

  • Mutants lacking functional MsbA show reduced survival in planta due to impaired membrane integrity .

Biochemical Analysis

  • ATPase Activity: Assays measure ATP hydrolysis rates to evaluate MsbA functionality .

  • Lipid Binding: Fluorescence-based assays using labeled lipid A analogs assess transport efficiency .

Comparative Genomics Insights

  • Conservation: Homologs of MsbA exist in other Xanthomonas pathovars (e.g., X. citri pv. aurantifolii), suggesting evolutionary conservation of LPS biogenesis .

  • Regulatory Context: The msbA gene is co-regulated with other LPS biosynthesis genes in X. axonopodis .

Current Research Gaps

  • Structural Data: No high-resolution structures of X. axonopodis MsbA are available, though homology models based on E. coli MsbA (PDB: 3B5W) exist .

  • Host Interaction Mechanisms: The role of MsbA in modulating plant immune responses (e.g., PTI/ETI) remains underexplored .

Future Directions

  • Drug Targeting: Inhibitors of MsbA could disrupt LPS assembly, offering novel antibacterial strategies against citrus canker .

  • Structural Biology: Cryo-EM studies could elucidate conformational changes during ATP hydrolysis and lipid transport .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery time information.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please communicate with us in advance, as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the intrinsic stability of the protein itself.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize development of the specified tag.
Synonyms
msbA; XAC2087; ATP-dependent lipid A-core flippase; Lipid A export ATP-binding/permease protein MsbA
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-589
Protein Length
full length protein
Species
Xanthomonas axonopodis pv. citri (strain 306)
Target Names
msbA
Target Protein Sequence
MTISIDRPAPVSSWRTYRRLLAFAKPYRLLLVAALIAALIEAAGTTGFLALMKPITDETF IYKNAEVSRWLPVQIILLFVVRGVAGYITDMAMGKSARSIARDLRIKVMAKYLRLPGSRF DSEPVPSMLIRLGSDSDQVAQAAVDAVKVMIQQSLQVIGALALMLWHSWQVTLTILVLAP VLAWVMDKVARRYRRISHSIQESGAQLLQAADQTLSSHQEVKIYGAQQTEMERYGALANR NLRLAMKVESTRGISTATVQMIGAIGLSALLFVAGAQALAGRLTAGDFVVLMTSMLTIIP GLKQLTNVQNMVQRGLASAERLFSVLDSPDEPDQGTVPLTRAKGLIEFRDVTARYPGQVN PALADVSFVAQPGTVTAIVGRSGSGKSSLIKLIPRFYEAEAGQILLDGHPVQAYALADLR RQIALVGQQVMLFDGSIADNVAFGEMRNADAGKLERAILGANAMEFVAQLPEGLQSHVGT KGGRLSGGQRQRLAIARAMLKDAPVLILDEATAALDNESERLVQDALHKLMPDRTTLVIA HRLSTIEHADQVLVMDQGRIVERGTHHQLLAQGGLYSHLHGMQFRERQA
Uniprot No.

Target Background

Function
This protein is involved in lipopolysaccharide (LPS) biosynthesis. It translocates lipid A-core from the inner to the outer leaflet of the inner membrane. Transmembrane domains (TMD) form a pore in the inner membrane, and the ATP-binding domain (NBD) is responsible for energy generation.
Database Links

KEGG: xac:XAC2087

STRING: 190486.XAC2087

Protein Families
ABC transporter superfamily, Lipid exporter (TC 3.A.1.106) family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the primary function of MsbA protein in Xanthomonas axonopodis pv. citri?

The MsbA protein in X. axonopodis pv. citri functions as a Lipid A export ATP-binding/permease protein. It belongs to the ATP-binding cassette (ABC) transporter family and plays a crucial role in the transport of lipid A, an essential component of lipopolysaccharides (LPS), from the inner to the outer membrane of this gram-negative bacterium. The protein utilizes ATP hydrolysis to power this transport process, which is vital for maintaining the integrity of the bacterial outer membrane and contributing to bacterial viability .

What are the optimal storage conditions for recombinant Xanthomonas axonopodis pv. citri MsbA protein?

For optimal stability, the recombinant X. axonopodis pv. citri MsbA protein should be stored at -20°C/-80°C upon receipt, with aliquoting necessary for multiple uses to avoid repeated freeze-thaw cycles. Working aliquots can be maintained at 4°C for up to one week. The protein is typically supplied in a Tris/PBS-based buffer containing 6% Trehalose at pH 8.0 .

For reconstitution, it is recommended to:

  • Briefly centrifuge the vial before opening

  • Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Add glycerol to a final concentration of 50% for long-term storage

  • Prepare smaller working aliquots to minimize freeze-thaw cycles

How does Xanthomonas axonopodis pv. citri MsbA compare structurally to MsbA proteins from other Xanthomonas species?

When comparing the MsbA protein from X. axonopodis pv. citri to its homolog in X. campestris pv. vesicatoria, significant sequence similarity is observed. Both proteins consist of 589 amino acids and share highly conserved structural features. The comparative analysis reveals:

What expression systems are most efficient for producing recombinant Xanthomonas axonopodis pv. citri MsbA protein?

The most efficient expression system for producing recombinant X. axonopodis pv. citri MsbA protein is Escherichia coli. The published data indicates that E. coli provides several advantages for this bacterial membrane protein's expression, including:

  • Rapid growth and high protein yields

  • Well-established molecular tools for genetic manipulation

  • Compatibility with N-terminal His-tag fusion for purification

  • Ability to express the full-length protein (1-589 amino acids)

For optimal expression, the construct should be placed under the control of an inducible promoter system (such as T7) to allow controlled expression. Critical parameters to optimize include temperature (typically lowered to 18-25°C post-induction), induction time (4-16 hours), and inducer concentration to maximize protein yield while ensuring proper folding of this membrane protein .

What methods can be used to assess the purity and integrity of recombinant Xanthomonas axonopodis pv. citri MsbA protein?

Multiple complementary techniques should be employed to comprehensively assess the purity and integrity of recombinant X. axonopodis pv. citri MsbA protein:

  • SDS-PAGE analysis: To verify protein size (expected ~65 kDa) and purity (target >90%)

  • Western blotting: Using anti-His antibodies to confirm identity and integrity of the His-tagged protein

  • Size exclusion chromatography: To assess oligomeric state and detect aggregation

  • Circular dichroism spectroscopy: To evaluate secondary structure content and proper folding

  • ATPase activity assay: To confirm functional integrity through measurement of ATP hydrolysis rates

  • Mass spectrometry: For accurate mass determination and verification of post-translational modifications

The purity standard for research applications should exceed 90% as determined by SDS-PAGE, with functional assays confirming that the protein retains its native activity .

How can site-directed mutagenesis be optimized for studying functional domains of Xanthomonas axonopodis pv. citri MsbA?

Optimizing site-directed mutagenesis for studying X. axonopodis pv. citri MsbA functional domains requires a strategic approach targeting key residues in different functional regions:

Protocol Design:

  • Target Domain Selection:

    • Walker A and B motifs in nucleotide-binding domains (NBDs)

    • Transmembrane domains (TMDs) that form the translocation pathway

    • Coupling helices that transmit conformational changes

  • Primer Design Strategy:

    • Design primers with the desired mutation flanked by 15-20 nucleotides on each side

    • Ensure primers have similar melting temperatures (Tm > 78°C)

    • Verify absence of secondary structures using software tools

  • Critical Residues to Target:

DomainResidue PositionProposed MutationExpected Effect
Walker ALys379K379ADisruption of ATP binding
Walker BAsp504D504NImpairment of ATP hydrolysis
TMDPhe136, Tyr142F136A, Y142AAltered substrate specificity
Coupling helicesArg287, Glu290R287A, E290ADisrupted NBD-TMD communication
  • Functional Validation:

    • ATPase activity assays comparing wild-type and mutant proteins

    • Lipid A transport assays in reconstituted proteoliposomes

    • Thermal stability measurements to assess structural impacts

This systematic approach enables correlation of specific residues with functional aspects of the transport cycle and provides insights into the molecular mechanism of this important bacterial transporter .

How can molecular dynamics simulations be applied to understand conformational changes of Xanthomonas axonopodis pv. citri MsbA?

Molecular dynamics (MD) simulations offer powerful insights into the conformational dynamics of X. axonopodis pv. citri MsbA during its transport cycle. A comprehensive MD study would include:

  • System Preparation:

    • Build a homology model based on crystal structures of homologous transporters

    • Embed the protein in a lipid bilayer mimicking bacterial inner membrane composition

    • Solvate with explicit water molecules and add counterions

  • Simulation Protocol:

    • Run production MD simulations (minimum 500 ns) for different states:

      • Inward-facing apo state

      • Lipid A-bound state

      • ATP-bound state

      • Post-hydrolysis state

    • Apply enhanced sampling techniques to capture the complete transport cycle

  • Analysis Framework:

Analysis MethodInformation GainedImplementation
Principal Component AnalysisDominant modes of motionProDy or Bio3D packages
Distance MonitoringNBD dimerization dynamicsCustom scripts tracking Cα distances
Cavity AnalysisTransport pathway accessibilityHOLE or CAVER software
Hydrogen Bond NetworkStabilizing interactionsVMD HBonds plugin
Water AccessibilityHydration changesMDAnalysis toolkit
  • Validation Approaches:

    • Cross-reference with experimental data

    • Design mutations to test computational predictions

    • Compare with related ABC transporters

These simulations can reveal the molecular mechanism of lipid A recognition, the coupling between ATP binding/hydrolysis and transmembrane domain movements, and the pathway for substrate translocation across the membrane.

What is the relationship between Xanthomonas axonopodis pv. citri MsbA and bacterial pathogenicity?

The relationship between X. axonopodis pv. citri MsbA and bacterial pathogenicity is multifaceted and can be investigated through several experimental approaches:

  • Genetic Manipulation Studies:

    • Create MsbA knockdown strains using inducible antisense RNA

    • Compare virulence in plant infection models between wild-type and MsbA-deficient strains

    • Analyze changes in lipopolysaccharide (LPS) composition and membrane integrity

  • Host-Pathogen Interaction Analysis:

    • Examine how MsbA dysfunction affects bacterial survival within host environments

    • Assess impact on bacterial resistance to plant defense compounds

    • Measure alterations in bacterial adhesion to plant tissues

  • Systems Biology Approach:

    • Compare transcriptional profiles of MsbA with known virulence factors during infection

    • Analyze co-expression networks to identify functional associations

    • Implement comparative genomics across Xanthomonas pathovars

The pathogenicity relationship is likely mediated through:

  • Maintenance of outer membrane integrity essential for surviving host defense responses

  • Proper display of surface molecules involved in host recognition

  • Protection against antimicrobial compounds produced by the host plant

Understanding this relationship could provide insights into the importance of MsbA in the context of bacterial evolution and host adaptation. Research has shown that Xanthomonas species display varied pathogenicity based on their genetic makeup and host adaptation patterns, with certain pathovars being more virulent than others .

How can recombinant Xanthomonas axonopodis pv. citri MsbA be incorporated into proteoliposomes for functional transport assays?

Incorporating recombinant X. axonopodis pv. citri MsbA into proteoliposomes requires a systematic protocol to ensure proper orientation and functionality:

Detailed Protocol:

  • Liposome Preparation:

    • Create a lipid mixture mimicking bacterial inner membrane composition (70% phosphatidylethanolamine, 20% phosphatidylglycerol, 10% cardiolipin)

    • Dissolve lipids in chloroform, evaporate under nitrogen, and further dry under vacuum

    • Hydrate lipid film with buffer (50 mM Tris-HCl pH 7.5, 150 mM NaCl)

    • Subject to freeze-thaw cycles (5-10 times)

    • Extrude through polycarbonate filters (400 nm, then 200 nm)

  • Protein Incorporation:

    • Destabilize preformed liposomes with detergent (Triton X-100 or n-octylglucoside)

    • Add purified MsbA protein at lipid-to-protein ratio of 50:1 to 100:1 (w/w)

    • Remove detergent using Bio-Beads SM-2 or dialysis

    • Collect proteoliposomes by ultracentrifugation

  • Quality Control Assessments:

AssessmentMethodExpected Result
Protein orientationProtease protection assay~50% right-side-out orientation
Incorporation efficiencyProtein:lipid ratio determination0.5-2% protein by weight
Size distributionDynamic light scattering150-250 nm diameter
Membrane integrityCalcein leakage assay<15% leakage over 24 hours
  • Functional Transport Assays:

    • ATPase activity: Measure Pi release using malachite green

    • Transport assays: Monitor movement of fluorescently labeled lipid A analogs

    • ATP binding: Use fluorescent ATP analogs to measure binding kinetics

This methodology enables detailed characterization of transport mechanisms and can be used to investigate effects of mutations, inhibitors, or environmental factors on MsbA function .

How can high-throughput screening be optimized to identify inhibitors of Xanthomonas axonopodis pv. citri MsbA?

Optimizing high-throughput screening (HTS) for X. axonopodis pv. citri MsbA inhibitors requires a tiered approach balancing throughput, specificity, and agricultural relevance:

Screening Cascade Design:

  • Primary Assay Development:

    • ATP hydrolysis assay using malachite green detection

    • 384-well format for maximum throughput

    • Z' factor optimization (target >0.7)

    • Controls: EDTA (negative), vanadate (positive)

  • Compound Library Selection:

    • Natural product libraries (particularly plant-derived)

    • Agricultural chemical scaffolds with established safety profiles

    • Fragment-based libraries for novel chemical entities

  • Multi-tiered Screening Process:

StageAssay TypeThroughputConcentrationKey Parameters
PrimaryATP hydrolysis100,000+ compounds10 μM% inhibition
ConfirmationDose-response ATP hydrolysis~1,000 compounds0.1-50 μMIC50 values
SecondaryLipid A transport500-1,000 compounds1-25 μMTransport inhibition
Counter-screenHuman ABC transporter activity300-500 compounds1-25 μMSelectivity ratio
TertiaryX. axonopodis growth inhibition100-300 compounds0.1-100 μMMIC values
QuaternaryPlant infection models10-50 compounds1-100 μMInfection reduction
  • Hit Selection Criteria:

    • IC50 values <10 μM against MsbA

    • 10-fold selectivity versus human transporters

    • Efficacy in bacterial growth inhibition

    • Activity in plant infection models

    • Favorable physicochemical properties

  • Agricultural Application Considerations:

    • Water solubility for field application

    • Stability under environmental conditions

    • Low toxicity to beneficial organisms

    • Cost-effective synthesis routes

This comprehensive approach maximizes the chances of identifying agriculturally relevant inhibitors that could be developed into novel bactericides for controlling citrus canker and other diseases caused by X. axonopodis .

How do sequence variations in MsbA proteins across Xanthomonas species correlate with host specificity?

The correlation between MsbA sequence variations across Xanthomonas species and host specificity represents an intriguing area of research. A multilocus sequence analysis approach can reveal important patterns:

Comparative Analysis Framework:

  • Sequence Alignment Analysis:

    • Compare MsbA sequences from X. axonopodis pv. citri, X. campestris pv. vesicatoria, and other Xanthomonas pathovars

    • Identify variable regions versus conserved domains

    • Calculate evolutionary distances between sequences

  • Structure-Function Relationships:

    • Map sequence variations onto predicted structural models

    • Identify variations in substrate-binding regions

    • Analyze transmembrane domain differences

  • Host-Specificity Correlation:

    • Group MsbA sequences by host specificity of their respective pathovars

    • Perform statistical analysis to identify amino acid positions under positive selection

    • Correlate specific variations with host range patterns

Research on Xanthomonas pathovars has shown that well-defined pathovars generally cluster in monophyletic groups, with highly pathogenic strains forming distinct clonal complexes. The three major pathovars (pruni, corylina, and juglandis) show evidence of shared ancestry while maintaining host specificity . This suggests that membrane transporters like MsbA may have evolved specific adaptations to different host environments.

  • Evolutionary Implications:

    • Calculate selection pressure (dN/dS ratios) across the MsbA sequence

    • Identify recombination events that may have contributed to host adaptation

    • Assess the role of horizontal gene transfer in MsbA evolution

Understanding these correlations could provide insights into how membrane transporters contribute to host adaptation in plant pathogens and potentially reveal targets for pathogen-specific control strategies .

What are the differences in biochemical properties between recombinant Xanthomonas axonopodis pv. citri MsbA and its homologs from other bacterial species?

The biochemical properties of recombinant X. axonopodis pv. citri MsbA can be systematically compared with homologs from other bacterial species to understand evolutionary adaptations and functional conservation:

Comparative Biochemical Profile:

  • ATPase Activity Parameters:

PropertyX. axonopodis pv. citri MsbAE. coli MsbAOther Homologs
Km for ATP0.2-0.5 mM (estimated)0.3-0.8 mMSpecies-dependent
Vmax10-30 nmol/min/mg (estimated)20-50 nmol/min/mgSpecies-dependent
pH optimum7.5-8.0 (estimated)7.0-7.5Species-dependent
Temperature optimum30-37°C (estimated)37°CSpecies-dependent
  • Substrate Specificity Analysis:

    • Compare binding affinities for lipid A variants

    • Assess recognition of other lipid substrates

    • Evaluate species-specific substrate preferences

  • Stability and Structural Features:

    • Thermal stability profiles (melting temperatures)

    • Detergent compatibility and solubilization properties

    • Oligomeric state and conformational flexibility

  • Inhibitor Sensitivity Profiles:

    • Response to general ABC transporter inhibitors

    • Species-specific inhibition patterns

    • Correlation with structural variations

  • Post-translational Modifications:

    • Phosphorylation sites and their functional significance

    • Other modifications affecting activity

    • Regulatory mechanisms

These comparative analyses can reveal how evolutionary pressures have shaped MsbA function across different bacterial species and provide insights into potential species-specific targeting strategies for antimicrobial development. The observed differences may also correlate with the various ecological niches and host ranges of different Xanthomonas species .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.