Recombinant Xanthomonas axonopodis pv. citri Monofunctional biosynthetic peptidoglycan transglycosylase (mtgA)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us for preferential development.
Synonyms
mtgA; XAC3047; Biosynthetic peptidoglycan transglycosylase; Glycan polymerase; Peptidoglycan glycosyltransferase MtgA; PGT
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-246
Protein Length
full length protein
Species
Xanthomonas axonopodis pv. citri (strain 306)
Target Names
mtgA
Target Protein Sequence
MGTDAWDGKQAAPPRRARRWLRWLMAAPLLFAAASVLQVLILRVVDPPISSMMAGRYLEA WGEGDWSFSLHRQWRDYDKIAASLPISVVAAEDQQFPMHHGFDLQAIEKARDHNARGGRV RGASTISQQVAKNVFLWQGRSWVRKGLEAWYTVLIELFWPKQRILEMYLNVAEFGDGVYG AQAAAQQFWSKDAAGLSPSESARLAAVLPSPRRYDARRPGAFVQRRAGWIQRQARQLGGP AYLQAP
Uniprot No.

Target Background

Function

Peptidoglycan polymerase that catalyzes glycan chain elongation from lipid-linked precursors.

Database Links

KEGG: xac:XAC3047

STRING: 190486.XAC3047

Protein Families
Glycosyltransferase 51 family
Subcellular Location
Cell inner membrane; Single-pass membrane protein.

Q&A

Basic Research Questions

  • What is the role of mtgA in Xanthomonas axonopodis pv. citri cell wall synthesis?

Monofunctional biosynthetic peptidoglycan transglycosylase (mtgA) in Xanthomonas axonopodis pv. citri functions as a peptidoglycan polymerase that catalyzes glycan chain elongation from lipid-linked precursors. It specifically polymerizes lipid II molecules into glycan strands of peptidoglycans, which are essential components of the bacterial cell wall .

This enzyme belongs to the glycosyltransferase 51 family and plays a crucial role in peptidoglycan structure assembly, remodeling, and degradation . The functional importance of mtgA extends beyond basic cell wall maintenance to impact:

  • Cell wall expansion during bacterial growth

  • Septum division allowing cell separation

  • Cell wall remodeling enabling flagellar assembly

  • Facilitation of bacterial conjugation

  • Potential contributions to virulence mechanisms

For researchers investigating this enzyme, it's important to note that while mtgA is primarily characterized by its transglycosylase activity, its influence on bacterial physiology extends to multiple cellular processes that affect both growth and pathogenicity.

  • How does mtgA expression in Xanthomonas contribute to virulence?

Evidence suggests that peptidoglycan transglycosylases like mtgA play significant roles in Xanthomonas virulence through several mechanisms:

Studies of murein lytic transglycosylases (LTs) in Xanthomonas citri subsp. citri (XccA) demonstrated that these enzymes, which are functionally related to mtgA, contribute to virulence mechanisms . Research has shown that LTs carried by the TnXax1 transposon significantly influence pathogenicity in Xanthomonadales .

The virulence contribution occurs through several pathways:

Virulence FactorImpact of Transglycosylase ActivityExperimental Evidence
Biofilm formationModerate enhancementDeletion mutants showed reduced biofilm production in both NB and XVM2 media
Xanthan gum productionSlight enhancementSmall differences observed between wild-type and mutant strains
Cell aggregationLimited impactNo statistical significance observed in aggregation capacity
Bacterial motilityNo significant effectNo difference in swarming and swimming behavior after 96h

For researchers studying virulence mechanisms, it's advisable to examine mtgA in conjunction with other virulence factors rather than in isolation, as its contribution appears to be part of a complex network of pathogenicity determinants in Xanthomonas.

  • What experimental approaches are effective for studying mtgA enzyme activity?

Several methodological approaches can be employed to study mtgA enzyme activity:

In vitro enzymatic assays:

  • Measure the polymerization of lipid II substrate into peptidoglycan strands

  • Monitor the formation of glycosidic bonds using fluorescent or radioactively labeled substrates

  • Assess enzyme kinetics through spectrophotometric measurements

Functional complementation studies:
Similar to approaches used with other biosynthetic peptidoglycan transglycosylases, researchers can use complementation assays where the mtgA gene is reintroduced into deletion mutants to restore wild-type phenotypes . This approach can verify if recombinant mtgA is functionally active.

Structural biology approaches:

  • X-ray crystallography to determine protein structure

  • Site-directed mutagenesis to identify catalytic residues

  • Binding studies with substrates and inhibitors

Phenotypic assays:
Monitor changes in cell morphology, as seen in other bacterial systems where mtgA deletion altered cell diameter rather than polar axis length, creating "fat" rather than "tall" cells under specific conditions .

When designing these experiments, researchers should include appropriate controls and standardize conditions to ensure reproducibility and accuracy of results.

Advanced Research Questions

  • How can researchers generate site-directed mtgA deletion mutants in Xanthomonas axonopodis pv. citri?

Creating site-directed mtgA deletion mutants in Xanthomonas axonopodis pv. citri requires a methodical approach:

1. Construct design and preparation:

  • Design primers to amplify the regions flanking the mtgA gene (~1kb upstream and downstream)

  • Include appropriate restriction sites for subsequent cloning

  • Clone these fragments into a suicide vector containing a selectable marker (e.g., antibiotic resistance)

  • Ensure the construct maintains the reading frame to avoid polar effects on downstream genes

2. Transformation and selection:

  • Introduce the construct into Xanthomonas axonopodis pv. citri via electroporation

  • Select for single crossover events using appropriate antibiotics

  • Screen for double crossover events (gene replacement) by counter-selection

3. Mutant verification:
Follow verification protocols similar to those used in published Xanthomonas studies:

  • PCR analysis using primers that bind outside the targeted region

  • Sequencing to confirm precise deletion

  • Quantitative RT-PCR to confirm absence of mtgA expression

  • Phenotypic characterization (biofilm formation, virulence assays)

4. Complementation studies:

  • Create a complementation construct containing the wild-type mtgA gene

  • Transform the deletion mutant with this construct

  • Verify restoration of wild-type phenotypes

This methodology has been successfully applied for studying transglycosylase genes in Xanthomonas, as demonstrated in research examining TnXax1.1 (XAC_RS22275) and TnXax1.2 (XAC_RS16355) LT passenger genes .

  • What are the optimal expression systems and purification protocols for recombinant Xanthomonas axonopodis pv. citri mtgA?

For successful expression and purification of recombinant Xanthomonas axonopodis pv. citri mtgA, researchers should consider multiple expression systems and purification strategies:

Expression Systems Comparison:

Expression SystemAdvantagesConsiderationsRecommended Use Case
E. coliHigh yield, cost-effective, rapid growthPotential inclusion body formation, possible incorrect foldingInitial screening and structural studies
YeastPost-translational modifications, soluble expressionLower yield than E. coli, longer expression timeWhen solubility is an issue in E. coli
BaculovirusSuperior folding for complex proteins, high yieldTime-consuming, technically demandingWhen protein activity is not preserved in bacterial systems
Mammalian cellsNative-like modifications, complex foldingExpensive, lower yieldFor functional studies requiring authentic modifications

Purification Protocol:

  • Cell lysis and clarification:

    • Resuspend cell pellet in appropriate buffer (typically Tris/PBS-based, pH 8.0)

    • Lyse cells via sonication or mechanical disruption

    • Clarify lysate by centrifugation (20,000g, 30 minutes, 4°C)

  • Affinity purification:

    • Apply clarified lysate to appropriate affinity resin (His-tag purification is commonly used)

    • Wash with increasing imidazole concentrations to remove non-specific binding

    • Elute purified protein with high imidazole buffer

  • Further purification:

    • Size exclusion chromatography for higher purity

    • Ion exchange chromatography if needed

  • Storage optimization:

    • Add 5-50% glycerol for long-term storage

    • Aliquot to avoid freeze-thaw cycles

    • Store at -20°C/-80°C

For reconstitution, it's recommended to use deionized sterile water to achieve a concentration of 0.1-1.0 mg/mL .

  • How can researchers assess the impact of mtgA on Xanthomonas biofilm formation and virulence?

A comprehensive assessment of mtgA's impact on biofilm formation and virulence requires multi-faceted experimental approaches:

Biofilm Formation Assays:

  • Crystal violet staining method:

    • Grow wild-type and mtgA mutant strains in appropriate media (NB and in XVM2 which mimics in planta conditions)

    • Measure biofilm formation in both microtiter plates and borosilicate tubes

    • Quantify by measuring optical density at 590nm after crystal violet staining

  • Confocal laser scanning microscopy:

    • Use fluorescently labeled strains to visualize biofilm architecture

    • Analyze biofilm thickness, density, and spatial organization

Virulence Assessment:

  • Plant infection assays:

    • Inoculate host plants with wild-type and mtgA mutant strains

    • Monitor disease progression over time

    • Quantify bacterial populations in planta at various time points

  • Virulence-related phenotypes:

    • Cell aggregation assays: Measure optical density at 600nm over time (lower readings indicate higher aggregation)

    • Xanthan gum production: Quantify using gravimetric analysis following ethanol precipitation

    • Motility assays: Evaluate swarming and swimming behavior on appropriate media over 24-96 hours

Data Analysis:

  • Perform statistical analysis using Tukey's test at 1% probability (P < 0.01) or other appropriate statistical methods

  • Include multiple biological replicates (minimum of three independent experiments)

  • Present data as mean values with standard error

This methodological approach, similar to that used by Oliveira et al. in their study of lytic transglycosylases in Xanthomonas, allows for comprehensive characterization of mtgA's role in bacterial physiology and pathogenicity .

  • What strategies can be employed to investigate potential horizontal gene transfer of mtgA in Xanthomonas?

Investigating horizontal gene transfer (HGT) of mtgA in Xanthomonas requires a multidisciplinary approach:

1. Comparative genomics:

  • Perform whole-genome sequencing of multiple Xanthomonas strains

  • Compare mtgA sequences, codon usage patterns, and GC content across strains

  • Identify genomic islands, transposons, or integrative conjugative elements associated with mtgA

  • Look for signatures of TnXax1-like elements, which have been shown to play a significant role in evolution and pathogenicity in Xanthomonadales

2. Phylogenetic analysis:

  • Construct phylogenetic trees using mtgA sequences from diverse bacterial species

  • Compare mtgA gene trees with species trees to identify incongruences suggestive of HGT

  • Use appropriate evolutionary models and statistical tests to assess tree reliability

3. Molecular evidence:

  • Analyze flanking regions for mobile genetic elements or integration sites

  • Examine nucleotide composition bias compared to the core genome

  • Screen for insertion sequences or prophage sequences near mtgA

4. Experimental verification:

  • Design transfer experiments to test the mobility of mtgA-containing genetic elements

  • Use fluorescently labeled DNA to track transfer events

  • Employ selection markers to identify successful transfer events

5. Functional analysis:

  • Compare enzymatic activities of mtgA variants from different sources

  • Investigate whether horizontally acquired mtgA confers novel phenotypes or adaptive advantages

  • Test virulence phenotypes in complementation studies with mtgA variants

This approach would provide comprehensive evidence for HGT of mtgA and its potential contribution to virulence and host adaptation in Xanthomonas species, similar to studies that demonstrated horizontal transfer of TnXax1 elements in Xanthomonadales .

Technical Research Questions

  • What are the most effective methods for studying mtgA-inhibitor interactions for potential antimicrobial development?

Investigating mtgA-inhibitor interactions requires a systematic approach combining computational, biochemical, and biological methods:

Computational Methods:

  • Structure-based virtual screening:

    • Generate or obtain a 3D structure of Xanthomonas mtgA through homology modeling or X-ray crystallography

    • Perform molecular docking simulations with compound libraries

    • Rank compounds based on binding energy and interaction patterns

  • Pharmacophore modeling:

    • Identify key structural features required for inhibitor binding

    • Screen compound databases using the pharmacophore model

    • Validate through molecular dynamics simulations

Biochemical Assays:

  • Enzyme inhibition assays:

    • Develop a high-throughput fluorescence-based assay measuring transglycosylase activity

    • Screen potential inhibitors at multiple concentrations

    • Determine IC50 values and inhibition mechanisms (competitive, non-competitive)

  • Binding studies:

    • Isothermal titration calorimetry (ITC) to determine binding constants

    • Surface plasmon resonance (SPR) to analyze binding kinetics

    • Thermal shift assays to assess protein stability upon inhibitor binding

Biological Validation:

  • Growth inhibition assays:

    • Determine minimum inhibitory concentration (MIC) against Xanthomonas

    • Assess growth curves in the presence of inhibitors

    • Test for synergistic effects with existing antibiotics

  • Resistance development:

    • Serial passage experiments to evaluate resistance emergence

    • Whole-genome sequencing of resistant mutants

    • Characterization of resistance mechanisms

  • In planta studies:

    • Evaluate efficacy in controlling bacterial infection in plant hosts

    • Assess phytotoxicity and environmental impact

    • Test delivery methods for field application

This methodological approach would provide a comprehensive evaluation of potential mtgA inhibitors, similar to approaches used in developing bacteriophage-based controls for Xanthomonas infections .

  • How can Material Transfer Agreements (MTAs) impact collaborative research on Xanthomonas mtgA, and what strategies can facilitate reagent sharing?

Material Transfer Agreements (MTAs) can significantly impact collaborative research on Xanthomonas mtgA in several ways:

Challenges in Reagent Sharing:

  • Complex MTAs can delay or prevent essential collaborations, as highlighted in surveys where 47% of geneticists reported being denied access to reagents associated with published research

  • Restrictive MTAs may grant the original developer far-reaching ownership of downstream discoveries, limiting research applications

  • Academic institutions may implement overly protective MTAs that create barriers to scientific progress

Strategies for Effective Reagent Sharing:

  • Utilize standardized agreement templates:

    • Adopt the Universal Biological Material Transfer Agreement (UBMTA) developed by NIH for transfers between academic researchers

    • Consider simplified "short form" agreements like those used by Howard Hughes Medical Institute

  • Budget for reagent distribution:

    • Include costs of distributing reagents in grant applications, as now permitted by NIH

    • Establish dedicated research material repositories with standardized distribution policies

  • Establish clear institutional policies:

    • Develop institutional guidelines that balance intellectual property protection with scientific advancement

    • Create streamlined approval processes for non-commercial research use

  • Leverage research foundations:

    • Consider partnering with foundations like CHDI Foundation that facilitate "easy access to validated biological reagents" to remove resource barriers

    • Establish collaborations with public repositories that have standardized MTA policies

For Xanthomonas mtgA research specifically, engaging with dedicated microbial culture collections like ATCC (which maintains Xanthomonas axonopodis strains) can provide access to source material under predictable MTA terms, facilitating collaborative efforts to study this important enzyme.

  • What controls and validation steps are essential when characterizing mtgA mutants in Xanthomonas?

Rigorous controls and validation are critical for accurate characterization of mtgA mutants:

Genetic Validation:

  • Confirmation of mutation:

    • PCR verification with primers flanking the deleted region

    • Whole-genome sequencing to confirm precise mutation and absence of off-target effects

    • RT-PCR and qRT-PCR to verify absence of mtgA expression

  • Complementation studies:

    • Reintroduce wild-type mtgA gene on a plasmid or integrated into the chromosome

    • Include proper promoter elements to ensure native-like expression levels

    • Verify restoration of wild-type phenotypes to confirm phenotypic changes are due to mtgA mutation

Phenotypic Characterization Controls:

  • Growth condition standardization:

    • Test multiple growth media including standard laboratory media and plant-mimicking media (e.g., XVM2)

    • Examine multiple growth phases (lag, logarithmic, stationary)

    • Compare behavior in liquid culture versus solid media

  • Microscopy and morphological analysis:

    • Compare cell size, shape, and ultrastructure between wild-type and mutant strains

    • Measure multiple parameters (length, width, surface-to-volume ratio)

    • Use appropriate staining techniques to visualize cell wall alterations

  • Biochemical analysis:

    • Measure peptidoglycan composition and cross-linking

    • Quantify relevant virulence factors (e.g., xanthan gum production)

    • Assess resistance to cell wall-targeting antibiotics

Functional Assays:

  • Virulence studies:

    • Include multiple plants/varieties to assess host range effects

    • Quantify bacterial populations in planta at multiple time points

    • Document symptom development with standardized scoring systems

  • Biofilm formation:

    • Test in multiple experimental systems (microtiter plates, flow cells, plant surfaces)

    • Include appropriate positive and negative controls

    • Perform statistical analysis across multiple biological replicates

This comprehensive validation approach, similar to that used in studies of lytic transglycosylases in Xanthomonas , ensures reliable characterization of mtgA mutant phenotypes.

Specialized Research Applications

  • How does mtgA function compare between Xanthomonas axonopodis pv. citri and other bacterial phytopathogens?

Comparing mtgA function across bacterial phytopathogens requires a systematic comparative analysis:

Sequence and Structural Comparison:

  • Multiple sequence alignment of mtgA proteins reveals conservation patterns and unique features

  • Structural modeling highlights catalytic domains and substrate-binding regions

  • Phylogenetic analysis places Xanthomonas mtgA in evolutionary context relative to other phytopathogens

Functional Differences:

Bacterial SpeciesmtgA CharacteristicsImpact on PathogenicityReference
Xanthomonas axonopodis pv. citriInvolved in peptidoglycan synthesis; may influence biofilm formationContributes to virulence mechanisms
Xanthomonas oryzae pv. oryzaeRelated enzyme (LT family member) hpa2 identifiedImplicated in pathogenicity
Escherichia colimtgA deletion increases cell diameter but not length; creates "fat" cellsEnhances polymer production
Shewanella amazonensismtgA characterized as peptidoglycan polymeraseNot specifically linked to pathogenicity

Methodological Approaches for Comparison:

  • Heterologous expression studies:

    • Express mtgA genes from different phytopathogens in a common host

    • Assess complementation efficiency in mtgA deletion backgrounds

    • Measure enzymatic activity under standardized conditions

  • Chimeric protein analysis:

    • Create fusion proteins with domains from different bacterial mtgA proteins

    • Map functional domains through activity assays

    • Identify species-specific features affecting substrate specificity or catalytic efficiency

  • Comparative transcriptomics:

    • Analyze expression patterns of mtgA across phytopathogens in similar conditions

    • Identify regulatory differences in response to environmental cues

    • Compare co-expression networks to understand functional context

This comparative approach would reveal how evolutionary diversification of mtgA contributes to the specific pathogenicity mechanisms of Xanthomonas axonopodis pv. citri versus other phytopathogens, providing insights into specialized adaptations for different host plants and infection strategies.

  • What role might mtgA play in Xanthomonas biofilm resistance to antimicrobial treatments?

The role of mtgA in biofilm resistance to antimicrobials is a complex area requiring multifaceted investigation:

Mechanistic Contribution to Antimicrobial Resistance:

  • Cell wall modification:

    • mtgA activity alters peptidoglycan structure, potentially affecting antimicrobial penetration

    • Changes in cell wall density or cross-linking can reduce binding of cell wall-targeting antimicrobials

    • Modified peptidoglycan may influence outer membrane stability and permeability barriers

  • Biofilm matrix interaction:

    • mtgA-dependent alterations in cell surface properties may affect attachment to exopolysaccharides

    • Changes in cell morphology can influence biofilm architecture and diffusion barriers

    • Peptidoglycan fragments released by transglycosylase activity might be incorporated into the biofilm matrix

Experimental Approaches:

  • Antimicrobial susceptibility testing:

    • Compare minimum biofilm eradication concentration (MBEC) between wild-type and mtgA mutant biofilms

    • Assess time-kill kinetics in biofilm versus planktonic states

    • Evaluate antimicrobial penetration using fluorescently-labeled compounds

  • Biofilm structure analysis:

    • Use confocal microscopy with live/dead staining to visualize antimicrobial effects

    • Employ atomic force microscopy to measure changes in biofilm mechanical properties

    • Analyze extracellular polymeric substance composition and distribution

  • Gene expression studies:

    • Perform RNA-seq to identify differentially expressed genes in mtgA mutants during antimicrobial exposure

    • Use reporter constructs to monitor stress responses in real-time

    • Analyze changes in expression of known resistance determinants

  • Combinatorial approaches:

    • Test mtgA inhibitors as adjuvants to enhance conventional antimicrobial efficacy

    • Evaluate phage-based control strategies in conjunction with mtgA modulation

    • Assess synergy between biofilm matrix degrading enzymes and cell wall-targeting compounds

Understanding mtgA's role in antimicrobial resistance could inform the development of novel strategies for controlling Xanthomonas infections, potentially combining bacteriophage treatments with targeted inhibition of cell wall biosynthesis pathways.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.