Recombinant Xanthomonas axonopodis pv. citri NADH-quinone oxidoreductase subunit K (nuoK)

What is NADH-quinone oxidoreductase subunit K (nuoK) in Xanthomonas axonopodis pv. citri and what are its basic properties?

NADH-quinone oxidoreductase subunit K (nuoK) is a component of the complex I respiratory chain in Xanthomonas axonopodis pv. citri, a Gram-negative bacterium responsible for citrus canker disease affecting all citrus cultivars . This protein functions as part of the proton-pumping NADH dehydrogenase complex, which catalyzes electron transfer from NADH to quinones while contributing to the establishment of a proton gradient across the membrane.

The protein consists of 101 amino acids with the sequence: MITLGHLLGLGAVLFCISLAGIFLNRKNVIVLLMSIELMLLSVNVNFIAFSRELGDTAGQLFVFFILTVAAAEAAIGLAILVTLFRTRRTINVAEVDTLKG . Based on its hydrophobic profile, nuoK is predicted to contain multiple transmembrane domains characteristic of integral membrane proteins.

How should researchers approach experimental design when studying nuoK function?

When designing experiments to investigate nuoK function, researchers should consider a multi-tiered approach:

• Start with recombinant expression and purification to obtain protein for in vitro studies

• Develop genetic manipulation strategies (such as CRISPR-based approaches identified in Xanthomonas species ) for in vivo functional analysis

• Compare phenotypes between wild-type and mutant strains focusing on:

  • Growth characteristics in different carbon sources

  • Membrane potential measurements

  • Respiratory capacity

  • Proton-pumping efficiency

  • Virulence-associated phenotypes (similar to those observed with LOV protein mutations )

The experimental design should incorporate appropriate controls, including complementation experiments to validate the specificity of observed phenotypes.

What expression systems yield optimal recombinant nuoK protein production?

Escherichia coli represents the preferred expression system for recombinant nuoK production. Current protocols utilize E. coli to express the full-length protein (amino acids 1-101) with an N-terminal His tag . When establishing expression protocols, researchers should optimize:

• E. coli strain selection (BL21(DE3), C41(DE3), or C43(DE3) for membrane proteins)

• Induction conditions (temperature, IPTG concentration, induction duration)

• Growth media composition (standard LB versus enriched media)

• Co-expression with chaperones if needed for proper folding

For membrane proteins like nuoK, lower induction temperatures (16-25°C) and longer expression times often yield better results than standard conditions.

What purification strategy provides the highest purity and yield for recombinant nuoK?

A systematic purification approach for recombinant His-tagged nuoK typically involves:

• Membrane fraction isolation through differential centrifugation

• Membrane solubilization using appropriate detergents (typically n-dodecyl-β-D-maltoside or similar)

• Immobilized metal affinity chromatography (IMAC) using Ni-NTA resin

• Size exclusion chromatography for further purification if needed

When properly executed, this protocol yields protein with greater than 90% purity as determined by SDS-PAGE . The purified protein should be maintained in detergent-containing buffers throughout the purification process to prevent aggregation.

What are the optimal storage conditions for maintaining nuoK stability?

Recombinant nuoK protein requires careful handling to maintain stability. The recommended storage protocol includes:

• Store lyophilized protein at -20°C/-80°C upon receipt

• After reconstitution, add glycerol to a final concentration of 5-50% (default recommendation is 50%)

• Aliquot for long-term storage at -20°C/-80°C to avoid repeated freeze-thaw cycles

• Working aliquots can be stored at 4°C for up to one week

The protein is typically supplied in a Tris/PBS-based buffer containing 6% trehalose at pH 8.0, which helps maintain stability during freeze-thaw cycles .

How can researchers methodically assess nuoK stability under different conditions?

To systematically evaluate nuoK stability under various conditions, researchers should implement:

• Thermal stability assays using differential scanning fluorimetry

• Time-course studies monitoring protein integrity by SDS-PAGE

• Functional assays measuring electron transport activity after storage at different temperatures

• Detergent screening to identify optimal micelle environments

Testing stability across a range of pH values (6.5-8.5), salt concentrations (0-500 mM NaCl), and with different additives (glycerol, sucrose, specific lipids) will help establish optimal buffer conditions for long-term storage and experimental use.

What methodological approaches can researchers employ to study nuoK electron transport function?

Researchers investigating nuoK function within the NADH dehydrogenase complex should consider these methodological approaches:

• Membrane potential measurements: Using potential-sensitive fluorescent dyes to monitor proton-pumping activity in membrane vesicles or proteoliposomes containing reconstituted nuoK.

• Electron transfer assays: Employing spectrophotometric methods to monitor NADH oxidation (340 nm) coupled with reduction of artificial electron acceptors like ferricyanide or ubiquinone analogs.

• Oxygen consumption assays: Using oxygen electrodes to measure respiratory rates in membrane preparations with varying substrates.

• Site-directed mutagenesis: Systematically altering conserved residues to identify those critical for electron transport or proton translocation.

Each functional assay should include appropriate controls, including specific inhibitors of the NADH dehydrogenase complex to confirm the specificity of measured activities.

How might nuoK function contribute to Xanthomonas axonopodis pv. citri virulence?

While direct evidence for nuoK's role in pathogenicity is not explicitly presented in the search results, its function as part of the respiratory chain suggests several potential contributions to virulence:

• Energy provision: The respiratory chain generates the ATP necessary for various virulence-associated processes, including motility, secretion system function, and biofilm formation.

• Adaptation to host environments: Efficient respiratory function may be critical for bacterial survival under changing nutrient availability during infection.

• Stress response: Proper energy metabolism is essential for mounting effective responses to host defense mechanisms.

By analogy with the LOV protein, which when deleted alters bacterial motility, exopolysaccharide production, biofilm formation, and adhesion , mutations in respiratory chain components like nuoK might similarly affect bacterial physiological features critical for host-pathogen interactions.

What experimental design would best elucidate nuoK's role during host infection?

To systematically investigate nuoK's contribution to pathogenicity, researchers should establish:

• Genetic manipulation system: Creating nuoK deletion mutants and complemented strains using methods similar to those established for other Xanthomonas proteins .

• Plant infection assays: Comparing disease development between wild-type, nuoK mutant, and complemented strains in citrus plants, similar to approaches used for studying the LOV protein's impact on virulence .

• Transcriptomic analysis: Examining changes in global gene expression patterns between wild-type and nuoK mutant strains during infection.

• Metabolic profiling: Assessing changes in bacterial metabolism during different stages of infection.

• Microscopy studies: Visualizing bacterial behavior in planta using fluorescently labeled strains.

Such a comprehensive approach would provide insights into how nuoK function influences the infection process and disease development.

How can CRISPR/Cas systems be applied to study nuoK function in Xanthomonas axonopodis pv. citri?

Based on the successful application of CRISPR/Cas systems in Xanthomonas oryzae pv. oryzae , researchers can develop similar approaches for studying nuoK:

• Target sequence selection: Identify appropriate target sequences within the nuoK gene that include the functional protospacer-adjacent motif (PAM). In Xanthomonas oryzae pv. oryzae, TTC at the 5′-end of the target sequence functions as an effective PAM .

• Spacer design optimization: Create spacers of sufficient length for effective targeting. Research in Xanthomonas oryzae pv. oryzae identified a minimum requirement of 27-bp spacer for successful self-target killing .

• Construct development: Engineer CRISPR constructs that mimic the native CRISPR cassette structure of Xanthomonas.

• Delivery and selection: Optimize transformation protocols for introducing CRISPR constructs into Xanthomonas axonopodis pv. citri.

• Mutant verification: Confirm gene editing through sequencing and expression analysis.

This approach enables precise genetic manipulation for functional studies of nuoK in its native context.

What methodological considerations are important when analyzing data from nuoK genetic experiments?

When analyzing results from nuoK genetic studies, researchers should consider the "response substitution" phenomenon identified in survey research , which can be conceptually applied to interpreting experimental results:

• Distinguish direct from indirect effects: Just as survey respondents may answer unasked questions , phenotypes observed in nuoK mutants might reflect indirect effects through other pathways rather than direct nuoK function.

• Control for compensatory mechanisms: Bacteria may activate alternative pathways to compensate for nuoK deficiency, potentially masking the protein's primary functions.

• Context-dependent interpretation: Like the restaurant diner who rates food poorly due to bad service , phenotypes must be interpreted within their proper biological context.

• Multiple experimental approaches: Combine genetic, biochemical, and physiological approaches to develop a comprehensive understanding of nuoK function.

• Provide "expression opportunities": Just as allowing survey respondents to express additional thoughts improved data validity , designing experiments that control for or measure compensatory responses will yield more accurate insights into nuoK function.

What analytical methods are most appropriate for studying nuoK structure-function relationships?

Due to nuoK's nature as a membrane protein, specialized techniques are required for detailed structural and functional analysis:

• Cryo-electron microscopy: For determining the structure of nuoK within the larger NADH dehydrogenase complex.

• Site-directed spin labeling combined with electron paramagnetic resonance spectroscopy: To analyze conformational changes during the catalytic cycle.

• Hydrogen-deuterium exchange mass spectrometry: To identify dynamic regions and protein-protein interaction interfaces.

• Reconstitution into nanodiscs or liposomes: To study function in a membrane-like environment.

• Electrophysiological measurements: To directly measure proton translocation activities.

These techniques should be applied systematically, working from protein purification through functional reconstitution to develop a comprehensive understanding of nuoK's structure-function relationships.

How can researchers address data inconsistencies when studying nuoK function?

When encountering conflicting or unexpected results in nuoK studies, researchers should apply a systematic troubleshooting approach:

• Protein quality assessment: Verify protein integrity, folding, and purity using multiple techniques (SDS-PAGE, size exclusion chromatography, circular dichroism).

• Experimental condition validation: Test activity across a range of pH values, temperatures, and salt concentrations to identify optimal conditions.

• Control comparisons: Include positive and negative controls in all functional assays to validate assay performance.

• Independent methodological approaches: Apply multiple techniques to measure the same functional parameter.

• Biological relevance confirmation: Connect in vitro observations to in vivo phenotypes through complementary studies.

This systematic approach allows researchers to distinguish genuine biological phenomena from experimental artifacts.