Recombinant Xanthomonas axonopodis pv. citri Phosphoglycerol transferase I (opgB)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Xanthomonas axonopodis pv. citri Phosphoglycerol Transferase I (opgB)

Recombinant Xanthomonas axonopodis pv. citri Phosphoglycerol transferase I (opgB) is a bioengineered enzyme derived from the bacterium Xanthomonas axonopodis pv. citri (Xac), the causal agent of Asiatic citrus canker. This protein is produced via heterologous expression systems, typically in E. coli or other microbial hosts, to study its biochemical properties and functional roles in bacterial pathogenicity. Phosphoglycerol transferases are enzymes involved in lipid metabolism, potentially modifying bacterial cell surface components or interacting with host plant immunity pathways.

Functional Roles in Pathogenicity

Xac employs effector proteins to manipulate host plant responses and establish infection. While opgB has not been extensively studied, its potential roles include:

  1. Modulation of Host Immunity:

    • Phosphoglycerol transferases may modify bacterial LPS to evade host recognition. Xac LPS is recognized as a pathogen-associated molecular pattern (PAMP), triggering basal defense responses .

    • Analogous to XacPNP, a plant natriuretic peptide homolog that reduces host necrosis and promotes bacterial survival .

  2. Lipid Metabolism and Membrane Stability:

    • Contributes to LPS synthesis, a critical virulence factor for biofilm formation and resistance to environmental stressors .

    • Mutations in LPS biosynthesis genes (e.g., wzt, rfb30) impair bacterial persistence in host tissues .

Applications in Research and Biotechnology

ApplicationDescriptionReferences
Pathogenicity StudiesDeletion mutants (ΔopgB) used to assess bacterial colonization and lesion severity.Analogous to avrXacE1 and avrXacE2 mutant analyses .
Host-Pathogen InteractionsRecombinant opgB used to probe interactions with plant proteins or lipids.Similar to XacPNP studies on stomatal regulation .
Diagnostic DevelopmentPotential target for antibody-based detection assays.Precedent from Xac effector protein-based PCR primers .

Research Gaps and Future Directions

  1. Structural and Functional Elucidation:

    • No crystallographic or enzymatic studies have been reported for opgB. Comparative analysis with Streptococcus pneumoniae phosphoglycerol transferases (e.g., PgtA) could provide mechanistic insights.

  2. Host Interaction Mechanisms:

    • Unresolved whether opgB directly interacts with plant receptors or modifies bacterial surfaces to avoid detection.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
opgB; mdoB; XAC0421; Phosphoglycerol transferase I; Phosphatidylglycerol--membrane-oligosaccharide glycerophosphotransferase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-702
Protein Length
full length protein
Species
Xanthomonas axonopodis pv. citri (strain 306)
Target Names
opgB
Target Protein Sequence
MHWMLLVSLLLLLWLLVASPRLAWLKAGLLSLFLLLLSAWGLVDRLSGDGINAATLYHLR ADMDGAGVSDFSGYIAVFVGMLLLSLSPLLLVRIRRFQRPRGGGAVFAGFVGMLLVGIAA SPLYRDGKRLYYQLRPVDYATVVPEYQVPQQPLHKRKNIVWIYGESLERTYFDEQVFPGL MPNLRAVATEAVDVRNLASTEGSGWTIAGMVASMCGVPLTTAPGDENSMDRMGMFLPEAR CLGDYLKDQGYRNHYVGGADASFAGKGRFLSSHGFDVVHDVHYFQDQGVAPKHFSAWGVH DDVLLDDAWDTFQTLSRAGQPFLLTTLTMDTHHPAGHLPSACKGQQYDSPLGDIGLLHAI KCSDRLIGELVARIRNSRYGKNTIIVIASDHLAMPNDLSDVLAKQKRENLLLFLGEDIAP QQVVTRAGSTLDSGATLLQLLEPGMRTLGFGRSFLASDAPPSASAAASRDSGKDYPRYLA YARTLWTGRSTRMLRINGNGDVVVGVQQVRPPVLLEYDKDTNLKTVYLENTSRQFDRTHS KGTLAYVDRCTAFEDGSADGDWCALVVDRHQSMKLYRDPDLARGIAIDAPLEATQQGPRP RVRQPIMLTQAARKTDAGRYMLELYAKRRPTRAFWVEAVSSERKVVLAQQWVVPDAAGRI RMPVGLEHAVEDLEIRAWLDYTEDVSVDDLALVKDIPVADRS
Uniprot No.

Target Background

Function
Transfers a phosphoglycerol residue from phosphatidylglycerol to the membrane-bound nascent glucan backbones.
Database Links

KEGG: xac:XAC0421

STRING: 190486.XAC0421

Protein Families
OpgB family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Phosphoglycerol transferase I (opgB) and what is its role in Xanthomonas axonopodis pv. citri?

Phosphoglycerol transferase I (opgB) is an enzyme in Xanthomonas axonopodis pv. citri (X. a. pv. citri) encoded by the opgB gene. It functions as a phosphatidylglycerol-membrane-oligosaccharide glycerophosphotransferase (EC 2.7.8.20) . This enzyme is involved in the synthesis of osmoregulated periplasmic glucans (OPGs), which play important roles in bacterial adaptation to environmental conditions, including osmotic stress. In X. a. pv. citri, opgB appears to be related to virulence mechanisms, particularly in the context of plant-pathogen interactions and biofilm formation .

How is opgB involved in biofilm formation in X. a. pv. citri?

The opgB protein contributes to periplasmic glucan synthesis, which is a critical component of the extracellular matrix in bacterial biofilms. Proteomics analyses have shown that during biofilm formation in X. a. pv. citri, there are significant changes in various membrane-associated proteins, including those involved in exopolysaccharide production and membrane transport . While not specifically identified among the differentially expressed proteins in the cited studies, opgB likely functions in the biosynthetic pathways that generate components of the biofilm matrix. Mutations affecting glucan biosynthesis have been demonstrated to impair structured biofilm formation and reduce virulence symptoms in X. a. pv. citri .

What expression systems are most effective for producing recombinant X. a. pv. citri opgB protein?

Based on protocols used for similar Xanthomonas proteins, Escherichia coli expression systems are commonly employed for the production of recombinant proteins from X. a. pv. citri. For opgB specifically, the recombinant protein expression should include:

  • Selection of an appropriate E. coli strain (BL21(DE3) or similar strains optimized for membrane protein expression)

  • Use of expression vectors containing T7 or similar strong promoters

  • Optimization of induction conditions (temperature, IPTG concentration, induction time)

  • Addition of appropriate tags for purification and detection (His-tag is commonly used)

For membrane-associated proteins like opgB, it may be necessary to use specialized expression systems with solubilizing agents or fusion partners to enhance solubility and proper folding.

What are the optimal methods for purifying recombinant opgB protein while maintaining its functional activity?

For optimal purification of functional recombinant opgB protein:

  • Use immobilized metal affinity chromatography (IMAC) if the protein contains a His-tag

  • Implement a stepwise purification protocol involving:

    • Cell lysis under native conditions using mild detergents (0.5-1% Triton X-100 or similar)

    • Initial purification with affinity chromatography

    • Secondary purification with ion exchange or size exclusion chromatography

    • Storage in a buffer containing glycerol (typically 50%) to maintain stability

Since opgB is a membrane-associated enzyme, particular attention should be paid to maintaining proper folding and activity during purification by including appropriate detergents or lipid-like molecules in purification buffers.

How can recombinant opgB be used to study biofilm formation in X. a. pv. citri?

Recombinant opgB can be utilized in several experimental approaches to study biofilm formation:

  • In vitro enzyme activity assays: To measure phosphoglycerol transferase activity and its correlation with biofilm formation capacity

  • Complementation studies: In opgB-deficient mutants to confirm its role in biofilm development

  • Protein-protein interaction studies: To identify binding partners within the biofilm matrix

  • Inhibitor screening: To develop compounds that may disrupt biofilm formation

Proteomics studies have shown that biofilm formation in X. a. pv. citri involves significant changes in protein expression patterns, particularly in membrane-associated proteins and transport systems . By studying purified recombinant opgB, researchers can determine its specific contributions to these processes.

What experimental models are most appropriate for studying the role of opgB in X. a. pv. citri pathogenicity?

Several experimental models have been validated for studying X. a. pv. citri pathogenicity:

  • In vitro biofilm formation assays:

    • Static microtiter plate biofilm assays

    • Flow cell systems for dynamic biofilm formation

    • Confocal microscopy for structural analysis

  • Plant infection models:

    • Orange (Citrus sinensis) leaf inoculation

    • Wound-inoculation assays

    • Detached leaf assays for controlled conditions

  • Mutant analyses:

    • Comparison of wild-type and opgB mutant strains

    • Complementation with recombinant opgB

    • Site-directed mutagenesis of key residues

These models can be used to correlate opgB function with pathogenicity traits such as bacterial motility, adhesion, biofilm formation, and disease development .

How does the molecular structure of opgB contribute to its function in periplasmic glucan synthesis?

While the complete three-dimensional structure of X. a. pv. citri opgB has not been fully characterized, structural analysis approaches should focus on:

  • Comparative modeling: Using related bacterial glycosyltransferases as templates

  • Identification of catalytic domains: Particularly the regions involved in substrate binding and phosphoglycerol transfer

  • Membrane interaction domains: As opgB is likely membrane-associated

  • Structure-guided mutagenesis: To validate the functional importance of specific residues

The protein sequence analysis indicates that opgB contains multiple transmembrane regions and motifs characteristic of glycosyltransferases . Understanding these structural features will provide insights into the mechanism of phosphoglycerol transfer during periplasmic glucan synthesis.

What is the relationship between opgB function and the LOV protein-mediated light sensing in X. a. pv. citri?

Studies have demonstrated that X. a. pv. citri possesses a LOV protein photoreceptor that modulates bacterial motility, exopolysaccharide production, and biofilm formation in response to blue light . While direct evidence for interaction between opgB and the LOV protein pathway is not established, there are several important research questions to explore:

  • Do light-sensing pathways regulate opgB expression or activity?

  • Does opgB-mediated periplasmic glucan synthesis change under different light conditions?

  • Do opgB mutants show altered phenotypes in light-response experiments?

Experiments could include:

  • Analysis of opgB expression under different light conditions

  • Evaluation of periplasmic glucan composition in LOV protein mutants

  • Double mutant analyses (opgB and LOV protein) to identify potential interactions

How might recombinant opgB be employed in developing novel control strategies for citrus canker?

Recombinant opgB could contribute to citrus canker control strategies through:

  • Target-based inhibitor screening: Identifying compounds that specifically inhibit opgB function

  • Vaccine development: Using inactive recombinant opgB as an antigen to induce plant defense responses

  • Diagnostic tool development: Creating antibody-based detection systems for early disease diagnosis

Current control strategies for X. a. pv. citri include copper-based treatments, which induce a viable but nonculturable (VBNC) state but do not completely prevent disease development . Targeting opgB function could provide a more specific approach to inhibit biofilm formation and reduce bacterial virulence.

What is the evolutionary significance of opgB in different pathovars of Xanthomonas axonopodis?

X. axonopodis comprises multiple pathovars that collectively affect a wide range of plants but individually display narrow host ranges . Evolutionary analysis of opgB across these pathovars could reveal:

  • Sequence conservation or divergence patterns correlating with host specificity

  • Evidence of recombination events affecting opgB structure and function

  • Selection pressures acting on opgB in different ecological niches

Studies have shown that recombination has played a major role in X. axonopodis evolution, with an impact about three times greater than mutation on observed diversity . Analysis of opgB evolution in this context could provide insights into the adaptation of different pathovars to their specific hosts.

How is opgB expression regulated in response to environmental conditions encountered during plant infection?

The regulation of opgB expression likely responds to various environmental signals encountered during plant infection:

  • Osmotic stress: As periplasmic glucans are involved in osmoadaptation

  • pH changes: When bacteria move from plant surface to apoplast

  • Nutrient availability: Particularly carbon source changes

  • Plant defense compounds: Including antimicrobial peptides and reactive oxygen species

Experimental approaches to study this regulation include:

  • Quantitative RT-PCR under different environmental conditions

  • Reporter gene fusions to monitor opgB promoter activity

  • Transcriptomic analysis of X. a. pv. citri during different infection stages

  • Identification of transcription factors controlling opgB expression

What role does opgB play in X. a. pv. citri dormancy and the viable but nonculturable (VBNC) state?

X. a. pv. citri can enter a viable but nonculturable (VBNC) state in response to copper treatment, while still maintaining the ability to cause disease . Research questions regarding opgB's role in this process include:

  • Is opgB expression altered during the transition to VBNC state?

  • Does opgB activity contribute to bacterial survival during dormancy?

  • Can manipulation of opgB function prevent recovery from the VBNC state?

Experimental approaches could include:

  • Analysis of opgB expression before and after copper treatment

  • Comparison of wild-type and opgB mutant survival in VBNC conditions

  • Evaluation of periplasmic glucan composition in VBNC cells

This research could provide insights into bacterial persistence mechanisms and improve control strategies for citrus canker.

How does opgB activity affect X. a. pv. citri recognition by plant defense systems?

The periplasmic glucans synthesized through opgB activity may influence how X. a. pv. citri interacts with plant immune responses:

  • PAMP recognition: Altered surface structures may affect recognition by pattern recognition receptors

  • Effector delivery: Changes in membrane properties could impact type III secretion system function

  • Defense evasion: Modified surface molecules may mask bacterial signatures

Experimental approaches to investigate these interactions include:

  • Comparison of plant defense responses to wild-type and opgB mutant strains

  • Analysis of PAMP-triggered immunity marker gene expression

  • Evaluation of effector protein translocation efficiency

Understanding these interactions could explain how X. a. pv. citri successfully colonizes host plants despite plant defense mechanisms.

What methodological challenges exist in studying opgB-host protein interactions?

Investigating interactions between bacterial opgB and host plant proteins presents several methodological challenges:

  • In planta expression: Difficulties in expressing and detecting bacterial proteins in plant tissues

  • Complex matrix effects: Plant cell wall and apoplastic fluid components may interfere with interaction studies

  • Temporal dynamics: Interactions may be transient or stage-specific during infection

Advanced techniques to overcome these challenges include:

  • Bimolecular fluorescence complementation (BiFC) for in planta interaction studies

  • Proximity labeling approaches (BioID, APEX) to identify neighboring proteins

  • Surface plasmon resonance (SPR) with purified components

  • Cross-linking mass spectrometry for capturing transient interactions

These approaches can provide insights into the role of opgB in X. a. pv. citri-plant interactions during the infection process.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.