Recombinant Xanthomonas axonopodis pv. citri Potassium-transporting ATPase C chain (kdpC)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
kdpC; XAC0758; Potassium-transporting ATPase KdpC subunit; ATP phosphohydrolase [potassium-transporting] C chain; Potassium-binding and translocating subunit C; Potassium-translocating ATPase C chain
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-206
Protein Length
full length protein
Species
Xanthomonas axonopodis pv. citri (strain 306)
Target Names
kdpC
Target Protein Sequence
MPLRDDGVLRGSLVLAVFTLFGLGLAYSLIATGITGALFSEQATGSLMRVDARVVGSALV AQPFTDARYFQPRPSAAKYDLTAAAGSNQARSNPDLLARIATTRAQVAARDGIAPEAVPG ELLTQSGSGLDPHLSPAGAQVQIRRVAAARGWPEQRVAALVQATTEAAPQFGLLGQPRVN VLALNLALDQAGNGESGRGNGVKQAH
Uniprot No.

Target Background

Function
This protein is a component of the high-affinity ATP-driven potassium transport (Kdp) system. It catalyzes ATP hydrolysis, coupled with the electrogenic transport of potassium ions into the cytoplasm. Specifically, this subunit functions as a catalytic chaperone, enhancing the ATP-binding affinity of the ATP-hydrolyzing subunit KdpB through the formation of a transient KdpB/KdpC/ATP ternary complex.
Database Links

KEGG: xac:XAC0758

STRING: 190486.XAC0758

Protein Families
KdpC family
Subcellular Location
Cell inner membrane; Single-pass membrane protein.

Q&A

What is the functional role of kdpC in Xanthomonas axonopodis pv. citri?

The kdpC protein functions as the C chain of a potassium-transporting ATPase complex in Xanthomonas axonopodis pv. citri. It forms part of a multi-component system responsible for high-affinity potassium ion uptake, which is critical for bacterial osmotic regulation, pH homeostasis, and cell viability under potassium-limited conditions. As part of the Kdp complex, kdpC works in coordination with kdpA (the channel-forming component) and kdpB (the catalytic ATP-hydrolyzing component) to drive potassium transport across the bacterial membrane . The protein is encoded by the gene kdpC (locus tag XAC0758) and plays an essential role in maintaining appropriate intracellular potassium levels, particularly under environmental stress conditions that commonly occur during plant-pathogen interactions .

How does the kdp operon in Xanthomonas differ from that in other bacteria?

The kdp operon in Xanthomonas and other members of the Xanthomonadaceae family exhibits a unique organization compared to the canonical kdp operon found in other environmental bacteria. While most bacteria possess a kdpFABC operon, Xanthomonas and related genera feature an expanded kdpXFABC operon that includes an additional gene, kdpX .

This distinctive organization is widespread in the Xanthomonadaceae family, including genera such as Lysobacter, Luteimonas, Pseudoxanthomonas, Stenotrophomonas, Xanthomonas, Thermomonas, and Vulcaniibacterium . In contrast, the canonical kdpFABC operon is the predominant form in other common environmental bacteria like Escherichia coli . The addition of the kdpX component likely confers unique functional properties to the potassium transport system in Xanthomonas, potentially related to its adaptation to plant-associated environments.

What are the optimal conditions for expressing recombinant Xanthomonas axonopodis pv. citri kdpC protein?

For optimal expression of recombinant X. axonopodis pv. citri kdpC protein, researchers should consider the following methodological approach:

  • Expression system selection: An E. coli-based expression system (such as BL21(DE3) or its derivatives) with a vector containing a strong inducible promoter (T7 or tac) is recommended for initial attempts.

  • Protein solubility enhancement: As a membrane-associated protein, kdpC may present solubility challenges. Consider using fusion tags (such as MBP, SUMO, or TrxA) to enhance solubility, or experiment with membrane protein-specific expression systems.

  • Expression conditions:

    • Initial induction: 0.5 mM IPTG at OD600 of 0.6-0.8

    • Temperature: Lower temperatures (16-20°C) often improve proper folding

    • Duration: Extended expression periods (overnight to 24 hours) at lower temperatures

  • Buffer optimization: For purification and storage, use Tris-based buffers (typically 50 mM Tris-HCl, pH 7.5-8.0) with 50% glycerol for long-term storage, as indicated in product specifications .

  • Storage conditions: Store purified protein at -20°C for short-term use or -80°C for extended storage. Avoid repeated freeze-thaw cycles and maintain working aliquots at 4°C for up to one week .

This methodology should yield functionally active recombinant kdpC protein suitable for downstream applications in potassium transport studies.

What techniques can be used to assay the functional activity of kdpC in vitro?

To assess the functional activity of recombinant kdpC protein in vitro, researchers can employ several complementary techniques:

  • ATPase Activity Assay: Measure ATP hydrolysis using:

    • Malachite green phosphate detection method

    • Coupled enzyme assays (pyruvate kinase/lactate dehydrogenase system)

    • Radioactive [γ-32P]ATP hydrolysis assays

  • Potassium Transport Assays:

    • Reconstitution of purified kdpC with kdpA and kdpB in proteoliposomes

    • Measurement of K+ uptake using K+-sensitive fluorescent dyes (PBFI)

    • 86Rb+ uptake assays as a tracer for potassium transport

  • Protein-Protein Interaction Studies:

    • Co-immunoprecipitation to verify kdpC interaction with kdpA and kdpB

    • Surface plasmon resonance (SPR) to determine binding kinetics

    • Fluorescence resonance energy transfer (FRET) for real-time interaction dynamics

  • Structural Analysis:

    • Circular dichroism (CD) spectroscopy to assess proper protein folding

    • Limited proteolysis to identify stable domains and interaction regions

For functional assessment, it's essential to include proper controls, particularly a non-functional kdpC mutant (e.g., with mutations in conserved residues) and to verify that the recombinant protein maintains its native conformation through at least two independent activity measures.

How does the regulation of kdpC expression relate to Xanthomonas pathogenicity?

The regulation of kdpC expression in Xanthomonas axonopodis pv. citri is intricately connected to bacterial pathogenicity through multiple regulatory pathways. HrpG and HrpX, two key transcriptional regulators that control the expression of virulence factors in X. axonopodis pv. citri, have been demonstrated to regulate potassium transport systems, including the kdp complex .

Genome-wide microarray analyses have revealed that HrpG and HrpX regulate multiple cellular activities responding to the host environment, including potassium transport . This regulatory connection suggests that modulation of potassium homeostasis is coordinated with the expression of virulence factors during the infection process.

The functional significance of this co-regulation likely relates to:

  • Osmotic adaptation: Maintaining appropriate osmotic balance during infection as the pathogen transitions between different host microenvironments.

  • pH regulation: Potassium transport systems contribute to pH homeostasis, which is crucial for the function of many virulence factors.

  • Energetic requirements: The coordination of nutrient acquisition systems (including potassium uptake) with virulence factor expression ensures that the bacterium has sufficient energetic resources to support pathogenesis.

  • Signal transduction: Potassium gradients may serve as signaling mechanisms that influence the expression of additional virulence factors.

The HrpG/HrpX regulon encompasses 232 and 181 genes, respectively, with 123 genes overlapping between these regulons . This overlap and the inclusion of potassium transport systems within these regulons demonstrate how X. axonopodis pv. citri coordinates multiple physiological processes, including potassium homeostasis, with virulence during plant infection.

What evolutionary relationships exist between kdpC in Xanthomonas and other bacterial species?

Evolutionary analysis of kdpC across bacterial species reveals significant insights into the adaptation and specialization of potassium transport systems. The kdpC protein in Xanthomonas axonopodis pv. citri shows variable sequence homology with kdpC from other bacterial species, reflecting both core conserved functions and lineage-specific adaptations.

Comparative analysis indicates that X. axonopodis pv. citri kdpC shares:

  • 56.9% homology with kdpC from Xanthomonas oryzae

  • Lower homology with kdpC from more distantly related bacteria

This moderate level of conservation suggests evolutionary pressures that maintain core functional domains while allowing for species-specific adaptations. The most notable evolutionary distinction is the organization of the kdp operon itself, with Xanthomonas and other members of the Xanthomonadaceae family featuring a unique kdpXFABC operon structure that includes the additional kdpX gene not found in other bacterial groups .

The evolutionary significance of this expanded operon structure likely relates to:

  • Plant-associated lifestyle: The unique operon organization may provide specialized functions for bacteria that interact with plant hosts.

  • Stress adaptation: The expanded system might confer enhanced ability to maintain potassium homeostasis under the specific stresses encountered in plant-associated environments.

  • Horizontal gene transfer: The consistent presence of this unique operon structure across the Xanthomonadaceae family suggests ancient acquisition and conservation of this specialized system.

Phylogenetic analysis of kdpC sequences places Xanthomonas in a distinct clade with other Xanthomonadaceae, separate from soil bacteria and animal pathogens, reflecting the specialized adaptation of this potassium transport system to the plant-associated bacterial lifestyle.

How do mutations in the kdpC gene affect bacterial fitness and virulence?

Mutations in the kdpC gene can significantly impact bacterial fitness and virulence through multiple mechanisms, particularly under potassium-limited conditions that commonly occur during host-pathogen interactions. Based on studies of potassium transport systems in related bacteria, the following effects can be anticipated:

Table 1: Effects of kdpC Mutations on Bacterial Phenotypes

Mutation TypeImpact on Protein FunctionEffect on K+ TransportImpact on Bacterial FitnessImpact on Virulence
Null mutationsComplete loss of kdpC functionSeverely impaired high-affinity K+ uptakeReduced growth in low K+ environmentsAttenuated virulence in planta
Missense mutations in conserved domainsPartial loss of functionReduced efficiency of K+ transportModerate growth defectsVariable virulence effects
Promoter mutationsAltered expression levelsDysregulated K+ homeostasisContext-dependent fitness effectsPotential virulence attenuation
C-terminal truncationsDisrupted interaction with kdpA/BImpaired complex formationReduced fitness under stressDecreased virulence

The integration of kdpC in the HrpG/HrpX regulon indicates that proper expression of this gene is coordinated with other virulence factors . Consequently, disruption of kdpC can have cascading effects on the expression of other virulence-associated genes, potentially through feedback mechanisms that sense potassium limitation or membrane potential alterations.

The impact of kdpC mutations on virulence is likely most pronounced in conditions that mimic the host environment, where potassium may be limiting and osmotic conditions fluctuate. Experimental evidence from related systems suggests that kdpC mutants would show:

  • Reduced competitive fitness in planta

  • Impaired ability to colonize specific host tissues

  • Decreased tolerance to defense-associated osmotic stresses

  • Potentially altered expression of type III secretion systems and effectors

These effects highlight the critical role of potassium homeostasis in supporting the physiological demands of the infection process and the integration of basic nutrient acquisition mechanisms with specialized virulence functions.

What are the most effective strategies for studying kdpC interactions with other proteins in the Kdp complex?

Investigating the interactions between kdpC and other components of the Kdp complex requires integrating multiple complementary approaches to fully characterize both stable and transient interactions. The following methodological strategies are particularly effective:

  • In vivo approaches:

    • Bacterial two-hybrid systems specifically designed for membrane protein interactions

    • Split fluorescent protein complementation assays (BiFC)

    • In vivo crosslinking followed by co-immunoprecipitation and mass spectrometry

    • FRET/FLIM approaches using fluorescently tagged Kdp components

  • In vitro biochemical approaches:

    • Co-purification of the entire Kdp complex using tandem affinity purification

    • Surface plasmon resonance with immobilized kdpC to measure binding kinetics

    • Isothermal titration calorimetry for thermodynamic parameters of interaction

    • Hydrogen-deuterium exchange mass spectrometry to map interaction interfaces

  • Structural biology approaches:

    • Cryogenic electron microscopy of the assembled Kdp complex

    • X-ray crystallography of co-purified components

    • NMR spectroscopy for mapping dynamic interactions

    • Cross-linking mass spectrometry to identify proximities within the complex

  • Computational approaches:

    • Molecular dynamics simulations of the Kdp complex

    • Protein-protein docking predictions

    • Coevolution analysis to identify co-evolving residues at interaction interfaces

When implementing these approaches, researchers should particularly focus on:

  • The interface between kdpC and the ATP-binding domain of kdpB

  • Potential interactions between kdpC and the unique kdpX component

  • Conformational changes in kdpC during the ATP hydrolysis cycle

  • The role of specific conserved residues in mediating protein-protein interactions

These methodologies, when used in combination, can provide a comprehensive understanding of how kdpC functions within the larger Kdp complex to facilitate potassium transport in Xanthomonas axonopodis pv. citri.

How can researchers effectively investigate the role of kdpC in bacterial responses to environmental stresses?

To effectively investigate kdpC's role in bacterial stress responses, researchers should employ a multi-faceted experimental approach that combines genetic manipulation, physiological measurements, and -omics technologies:

  • Genetic manipulation approaches:

    • Construction of clean deletion mutants (ΔkdpC) using allelic exchange

    • Complementation with wild-type and mutant alleles under native and inducible promoters

    • Creation of reporter fusions (kdpC promoter fused to fluorescent proteins or luciferase)

    • CRISPR-Cas9 genome editing for precise point mutations in conserved residues

  • Stress exposure and phenotypic characterization:

    • Systematic evaluation of growth under varying potassium concentrations (0.1-100 mM)

    • Osmotic stress challenges (NaCl, sorbitol, polyethylene glycol)

    • pH stress (acidic and alkaline conditions)

    • Oxidative stress (H₂O₂, paraquat)

    • Combined stresses that mimic plant defense responses

  • Physiological measurements:

    • Intracellular potassium concentration using flame photometry or ion-selective electrodes

    • Membrane potential using voltage-sensitive fluorescent dyes

    • Intracellular pH using ratiometric fluorescent probes

    • ATP levels and energy charge under stress conditions

  • Transcriptomic and proteomic analyses:

    • RNA-Seq comparing wild-type and ΔkdpC under various stress conditions

    • Chromatin immunoprecipitation sequencing (ChIP-Seq) to identify regulators binding to the kdp promoter

    • Proteomics to identify changes in protein abundance and post-translational modifications

    • Metabolomics to assess broader physiological impacts of kdpC disruption

Table 2: Experimental Design for Stress Response Analysis

Stress TypeStress ConditionsKey MeasurementsExpected Impact in ΔkdpC
Potassium limitationK⁺ range: 0.1-10 mMGrowth rate, intracellular K⁺Severe growth impairment below 1 mM K⁺
Osmotic stress0.1-0.5 M NaClCell volume, membrane integrityIncreased sensitivity to osmotic shock
pH stresspH 5.0-5.5, pH 8.0-8.5Intracellular pH, survival rateImpaired pH homeostasis
Oxidative stress0.1-1 mM H₂O₂ROS levels, antioxidant enzyme activityElevated sensitivity to oxidative damage
In planta stressInoculation of host tissueBacterial population, HR elicitationReduced fitness and persistence

This comprehensive experimental framework allows researchers to dissect both the direct physiological roles of kdpC in potassium homeostasis and its indirect impacts on broader stress response networks and virulence regulation in Xanthomonas axonopodis pv. citri.

How does the kdpC protein in Xanthomonas relate to novel potassium transport systems discovered in related bacteria?

Recent research has revealed important evolutionary and functional relationships between the kdpC protein in Xanthomonas axonopodis pv. citri and newly discovered potassium transport systems in related bacteria. Particularly significant is the identification of the LeKdpXFABC system in Lysobacter enzymogenes, another member of the Xanthomonadaceae family .

This novel potassium ion import system includes the typical kdpFABC components but notably contains an additional component, kdpX, which appears to be a defining feature of potassium transport systems in the Xanthomonadaceae family . Bioinformatic analyses have demonstrated that this expanded kdpXFABC operon structure is widely conserved across multiple genera within Xanthomonadaceae, including Lysobacter, Luteimonas, Pseudoxanthomonas, Stenotrophomonas, Xanthomonas, Thermomonas, and Vulcaniibacterium .

The functional significance of this expanded system likely relates to:

  • Enhanced environmental adaptation: The addition of kdpX may provide specialized functions that enhance potassium acquisition in the plant-associated environments where these bacteria typically reside.

  • Novel regulatory capabilities: The expanded system may allow for more sophisticated regulation of potassium transport in response to environmental signals encountered during plant colonization.

  • Altered bioenergetics: The additional component may affect the energy coupling of the transport process, potentially improving efficiency under specific conditions.

The most significant recent insight is that this kdpXFABC system has been linked to specific ecological niches. While traditional kdpFABC systems are typically found in soil bacteria and animal pathogens, the expanded system appears specialized for plant-associated bacteria, suggesting evolutionary adaptation to the unique challenges of the plant environment .

What are promising research directions for understanding how kdpC contributes to xyloglucan processing and cell wall degradation during infection?

Recent findings have established unexpected connections between potassium transport systems and cell wall degradation mechanisms in Xanthomonas pathogens, opening promising new research directions. Studies have shown that Xanthomonas bacteria possess machinery for xyloglucan depolymerization that is linked to pathogenesis, and the regulation of this machinery appears to be connected to basic physiological processes including potassium homeostasis .

The most promising research directions for understanding these connections include:

  • Investigating regulatory crosstalk: Examine how potassium limitation affects the expression of xyloglucan-degrading enzymes and vice versa. This could involve:

    • Transcriptomic analysis of wild-type and kdpC mutants exposed to xyloglucan

    • Chromatin immunoprecipitation to identify shared regulators between kdp genes and xyloglucan-processing genes

    • Reporter fusion assays to track real-time expression dynamics

  • Exploring functional coordination: Determine whether proper potassium homeostasis is required for optimal function of xyloglucan-degrading enzymes through:

    • Enzyme activity assays under varying potassium concentrations

    • In vitro reconstitution of xyloglucan processing with controlled ionic conditions

    • Structural studies of enzyme-substrate complexes under different ionic environments

  • Examining metabolic integration: Investigate how the sugars released by xyloglucan degradation affect potassium transport through:

    • Metabolic labeling studies to track carbon flow from xyloglucan to energy production

    • Measurement of membrane potential and potassium flux in response to xyloglucan-derived sugars

    • Proteomics to identify post-translational modifications of kdpC in response to changing carbon sources

The promising link between these systems comes from the observation that sugars released by the xyloglucan depolymerization machinery elicit the expression of several key virulence factors, including the type III secretion system . Since potassium transport systems are also regulated by key virulence regulators like HrpG and HrpX , there appears to be an integrated regulatory network connecting basic physiological functions like potassium transport with specialized virulence functions like plant cell wall degradation.

This interconnection represents an exciting frontier for understanding how Xanthomonas coordinates multiple aspects of its physiology to optimize infection success and could lead to novel strategies for controlling bacterial plant diseases.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.