Recombinant Xanthomonas axonopodis pv. citri Protease HtpX (htpX)

Shipped with Ice Packs
In Stock

Description

Overview of Xanthomonas axonopodis pv. citri

Xanthomonas axonopodis pv. citri (sometimes referred to as X. citri pv. citri) is a gram-negative bacterial plant pathogen responsible for citrus canker, a devastating disease that affects various citrus species globally . The disease manifests as lesions on leaves, stems, and fruit, leading to significant economic losses in citrus production. The pathogen exists in different pathotypes (A, A*, and Aw) which vary in their host range and virulence characteristics .

Role of HtpX in Bacterial Physiology

Within bacterial cellular machinery, HtpX protease plays a crucial role in protein quality control mechanisms, particularly in response to environmental stresses. HtpX belongs to the family of membrane-bound proteases involved in the degradation and processing of other proteins. It functions as a zinc-dependent metalloprotease, meaning it requires zinc ions for its catalytic activity . The name "HtpX" reflects its nature as a heat shock protein (Htp), indicating its involvement in cellular response to thermal stress, though its functions extend beyond temperature adaptation alone.

Significance in Bacterial Stress Response

In bacterial physiology, proteases like HtpX are essential for maintaining protein homeostasis by removing damaged, misfolded, or unnecessary proteins. This protein quality control is particularly important for membrane proteins, which must maintain specific conformations to function properly. Research on similar HtpX proteins in other bacteria suggests that it participates in the proteolytic quality control of membrane proteins in conjunction with FtsH, another membrane-bound and ATP-dependent protease .

Protein Sequence and Domain Organization

The recombinant HtpX from Xanthomonas axonopodis pv. citri (strain 306) is identified in the UniProt database with the accession number Q8PJX8 . The full-length protein consists of 292 amino acid residues with the following sequence:

MFNRIFLFLLTLAVLMLAGIVMSLLGVNPAQMSGLLVMAAIFGFGGSFISLLLSKFMAKRSTGAQVITEPRTPTERWLLETVRRQAQAAGIGMPEVAVYEGPEINAFATGANRNNALVAVSTGLLQNMDQDEAEAVLGHEIAHVANGDMVTMALLQGVLNTFVIVLARVVGGIIDSTLSGNREGGRGFAYYIIVFALEMVFGLFATMIAMWFSRRREFRADAGGAQLAGRSKMIAALER LSLNHGQNTLPSQVQAFGISGGVGEGLRRLFLSHPPLTERIAALRAASGSAR

The protein contains transmembrane regions that anchor it to the bacterial cell membrane, consistent with its classification as a membrane-bound protease. The most critical functional domain is the zinc-binding region, which forms the catalytic site responsible for its proteolytic activity.

Comparison with Related Proteins

The HtpX protein shows significant sequence and structural similarity to homologous proteins in other Xanthomonas species. For example, the HtpX from Xanthomonas oryzae pv. oryzae shares many structural features, though with some amino acid differences . The table below compares key sequences between these related proteins:

FeatureX. axonopodis pv. citri HtpXX. oryzae pv. oryzae HtpX
UniProt IDQ8PJX8B2SHQ4
Protein Length292 amino acids292 amino acids
N-terminal sequenceMFNRIFLFLLTNLAVLMFNRIFLFLLTNVAVL
Key differencesAVLMLAGIVMSLLGVNPAQMAVLMLAGVVMSVLGVNPAQM
Catalytic regionSimilar zinc-binding motifSimilar zinc-binding motif

These structural similarities reflect the evolutionary conservation of this important protease across different Xanthomonas species, suggesting a fundamental role in bacterial physiology.

Proteolytic Mechanism

HtpX functions as a zinc-dependent metalloprotease, utilizing zinc ions as cofactors in its catalytic mechanism . The proteolytic activity involves the coordination of a zinc ion in the active site, which facilitates the hydrolysis of peptide bonds in substrate proteins. This mechanism is similar to that observed in other zinc metalloproteases, where the metal ion activates a water molecule that acts as a nucleophile in the peptide bond cleavage.

Studies on similar HtpX proteins, particularly in Escherichia coli, have demonstrated that HtpX undergoes self-degradation upon cell disruption or membrane solubilization . This autoproteolytic activity is zinc-dependent and represents an important regulatory mechanism for controlling the protease's own levels within the cell. Research has confirmed that when supplemented with Zn2+, the purified enzyme exhibits self-cleavage activity .

Substrate Specificity and Proteolytic Activity

HtpX exhibits specificity for certain protein substrates. Research on HtpX from E. coli has shown that it can degrade casein (a model substrate for proteases) and cleave SecY, a membrane protein involved in protein translocation . This suggests that the Xanthomonas axonopodis pv. citri HtpX may have similar substrate preferences, particularly targeting membrane proteins that require quality control.

The following table summarizes the key functional properties of HtpX:

PropertyDescriptionEvidence
Catalytic TypeZinc metalloproteaseRequires zinc ions for activity
Self-cleavageUndergoes autoproteolysisObserved in presence of zinc
Substrate RangeMembrane proteins, including SecYDemonstrated in related HtpX proteins
Functional PartnersWorks with FtsH proteaseCooperative protein quality control
Stress ResponseInvolved in heat shock responseImplied by classification as heat shock protein

The protease is believed to work in conjunction with other proteolytic systems in the bacterial cell. Specifically, it has been suggested to cooperate with FtsH, another membrane-bound ATP-dependent protease, in the quality control of membrane proteins . This cooperation may involve sequential or complementary proteolytic processing of damaged or misfolded proteins.

Recombinant Expression and Purification

The recombinant production of Xanthomonas axonopodis pv. citri HtpX typically involves heterologous expression in bacterial hosts, most commonly Escherichia coli. This approach allows for controlled expression and simplified purification of the target protein. Based on similar recombinant proteins, the expression may be optimized by adjusting factors such as induction conditions, temperature, and duration to maximize yield while maintaining proper folding .

The purification of recombinant HtpX presents challenges due to its membrane-associated nature and potential for self-degradation. Data from similar proteins suggests that purification under denaturing conditions followed by refolding in the presence of zinc chelators may be necessary to obtain intact, functional enzyme . For example, in studies with E. coli HtpX, the protein was purified under denaturing conditions and then refolded in the presence of a zinc chelator to prevent self-degradation .

Investigation of Bacterial Physiology

Recombinant HtpX provides a valuable tool for investigating fundamental aspects of bacterial physiology, particularly membrane protein quality control mechanisms. Studies using the recombinant protein can help elucidate how bacteria maintain membrane homeostasis under various environmental conditions, including stress responses.

Development of Antimicrobial Strategies

As a bacterial protease essential for cellular function, HtpX represents a potential target for antimicrobial development. Recombinant HtpX can be used in inhibitor screening assays to identify compounds that might interfere with its proteolytic activity. Such compounds could potentially be developed into antimicrobial agents specific to Xanthomonas species, offering new approaches to controlling citrus canker.

Cross-Species Analysis

Several Xanthomonas species possess HtpX proteases with similar structures and functions, including Xanthomonas oryzae pv. oryzae (which infects rice) and Xanthomonas campestris pv. campestris (which infects cruciferous plants) . Comparative analysis reveals high sequence conservation with species-specific variations that may reflect adaptation to different host plants.

Sequence and Functional Conservation

The table below presents a comparative analysis of HtpX across different Xanthomonas species:

FeatureX. axonopodis pv. citriX. oryzae pv. oryzaeX. campestris pv. campestris
Host PlantCitrus speciesRiceCruciferous plants
Protein Length292 amino acids292 amino acidsPartial information available
Commercial AvailabilityAvailable as recombinant protein Available as recombinant protein Available as partial recombinant protein
Key FunctionZinc-dependent membrane proteaseZinc-dependent membrane proteasePresumed similar proteolytic activity

The conservation of HtpX across these plant pathogenic bacteria suggests its fundamental importance in bacterial physiology, while subtle variations may reflect species-specific adaptations related to their distinct ecological niches and host plants.

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, but this can be adjusted to customer specifications.
Shelf Life
Shelf life depends on storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is finalized during production. To prioritize a particular tag type, please specify your requirements during order placement.
Synonyms
htpX; XAC2399; Protease HtpX; Heat shock protein HtpX
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-292
Protein Length
full length protein
Species
Xanthomonas axonopodis pv. citri (strain 306)
Target Names
htpX
Target Protein Sequence
MFNRIFLFLLTNLAVLMLAGIVMSLLGVNPAQMSGLLVMAAIFGFGGSFISLLLSKFMAK RSTGAQVITEPRTPTERWLLETVRRQAQAAGIGMPEVAVYEGPEINAFATGANRNNALVA VSTGLLQNMDQDEAEAVLGHEIAHVANGDMVTMALLQGVLNTFVIVLARVVGGIIDSTLS GNREGGRGFAYYIIVFALEMVFGLFATMIAMWFSRRREFRADAGGAQLAGRSKMIAALER LSLNHGQNTLPSQVQAFGISGGVGEGLRRLFLSHPPLTERIAALRAASGSAR
Uniprot No.

Target Background

Database Links

KEGG: xac:XAC2399

STRING: 190486.XAC2399

Protein Families
Peptidase M48B family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is HtpX protease and what is its function in Xanthomonas axonopodis pv. citri?

HtpX in Xanthomonas axonopodis pv. citri is a member of the M48 family zinc metalloproteinases located in the cytoplasmic membrane. Similar to its homologs in other bacteria, it is primarily involved in proteolytic quality control of membrane proteins, helping to eliminate malfolded and/or misassembled proteins that could disrupt membrane integrity and function . The protease contains multiple hydrophobic regions that function as transmembrane segments, though the exact membrane topology may vary between bacterial species . Based on studies in other bacteria, HtpX likely contributes to stress response mechanisms in Xanthomonas, though its specific regulatory patterns may differ from those observed in species like Pseudomonas aeruginosa .

How does HtpX relate to the HrpG/HrpX regulatory system in Xanthomonas?

It's important to note that despite the similar name, HtpX protease is distinct from the HrpX transcriptional regulator in Xanthomonas. HrpX is part of the HrpG/HrpX regulon that controls the Type 3 Secretion System (T3SS) and associated effectors critical for Xanthomonas pathogenicity . The HrpX regulator is an AraC-type transcriptional activator of approximately 476 amino acids that binds to plant-inducible promoter (PIP) box motifs (TTCGB-N15/N8-TTCGB) to induce gene expression . In contrast, HtpX protease functions at the protein level rather than the transcriptional level, involved in membrane protein quality control. These two proteins serve different functions in Xanthomonas biology despite their similar nomenclature.

What structural features characterize the HtpX protease?

Based on homology with other bacterial HtpX proteins, Xanthomonas axonopodis pv. citri HtpX likely contains four hydrophobic regions (H1-H4) that can function as transmembrane segments . The active site typically includes a zinc-binding HEXXH motif characteristic of metallopeptidases . The membrane topology of HtpX can be complex, with some debate about whether all hydrophobic regions are truly membrane-embedded. Studies in E. coli have shown that while the first two hydrophobic regions are clearly transmembrane, the C-terminal regions may have more variable membrane association . This structural arrangement positions the catalytic domain optimally for interaction with membrane protein substrates.

What are effective strategies for recombinant expression of Xanthomonas axonopodis pv. citri HtpX?

Successful recombinant expression of membrane proteases like HtpX requires careful optimization. Based on approaches used for E. coli HtpX, an effective strategy would involve:

  • Vector selection: pET-derived vectors with C-terminal His-tags (His8 or His10) have proven successful for similar membrane proteases .

  • Expression hosts: E. coli BL21(DE3) is often suitable for initial expression trials .

  • Expression conditions: Lower induction temperatures (16-20°C) and extended expression times may improve proper folding.

  • Catalytic mutations: For structural studies, creating a catalytically inactive mutant by altering the HEXXH motif can improve stability while maintaining native folding .

The following table summarizes optimization parameters based on successful approaches with related proteases:

ParameterRecommended ConditionsRationale
VectorpET with C-terminal His8-tagMinimizes tag interference with membrane insertion
Host strainE. coli BL21(DE3)Lacks proteases that could degrade target protein
Induction temperature16-20°CSlows expression rate to allow proper folding
Inducer concentration0.1-0.5 mM IPTGLower concentrations reduce formation of inclusion bodies
Expression time16-20 hoursExtended time compensates for slower expression rate

What are the most effective detergents for extraction and purification of recombinant HtpX?

Membrane protein extraction requires careful detergent selection. For HtpX homologs, octyl-β-D-glucoside has been successfully employed . The extraction and purification process should include:

  • Membrane isolation: Separating membrane fractions through ultracentrifugation after cell lysis.

  • Detergent screening: Testing multiple detergents (DDM, LDAO, octyl-β-D-glucoside) for extraction efficiency.

  • Sequential purification: Metal affinity chromatography (cobalt or nickel) followed by ion exchange and size exclusion chromatography has proven effective for related proteases .

For Xanthomonas HtpX specifically, maintaining detergent concentration above critical micelle concentration throughout all purification steps is essential to prevent protein aggregation. Additionally, inclusion of zinc in purification buffers may help maintain structural integrity of the metalloprotease domain.

How can the activity of purified recombinant HtpX be verified?

Verifying the proteolytic activity of recombinant HtpX requires development of appropriate assays. An approach similar to that developed for E. coli HtpX could be adapted:

  • Model substrate construction: Design fusion proteins containing known or predicted cleavage sites flanked by detectable tags (GFP, epitope tags) .

  • In vitro assay: Incubate purified HtpX with the model substrate and detect cleavage products via immunoblotting.

  • In vivo assay: Co-express HtpX and the model substrate in a suitable host and monitor substrate processing .

Comparing wild-type HtpX with catalytic site mutants (alterations in the HEXXH motif) provides essential negative controls. For quantitative assessment, fluorescence-based assays using quenched fluorogenic peptides could be developed if specific cleavage sites are identified.

How can HtpX substrate specificity be determined in Xanthomonas axonopodis pv. citri?

Determining substrate specificity requires multi-faceted approaches:

  • Bioinformatic prediction: Analyze membrane proteomes for potential recognition motifs based on known substrates from other bacteria.

  • Proteomics approach: Compare membrane protein profiles between wild-type and ΔhtpX strains under stress conditions using quantitative proteomics.

  • Model substrate variants: Create a library of model substrates with systematic variations in potential cleavage regions to define sequence preferences .

  • In vivo confirmation: Validate predicted substrates through co-expression studies with tagged versions of candidate proteins.

Current evidence from E. coli suggests HtpX may target misfolded membrane proteins, but the exact recognition elements remain poorly defined . Xanthomonas-specific substrates likely include proteins involved in stress response and possibly virulence factors, though direct evidence is currently limited.

What role does HtpX play in Xanthomonas stress response pathways?

While specific data for Xanthomonas axonopodis pv. citri HtpX is limited, research on related bacteria suggests variable roles in stress response:

  • In E. coli, HtpX functions in coordination with other proteases in response to membrane protein misfolding.

  • In Pseudomonas aeruginosa, htpX abundance patterns differ from other stress response genes, suggesting a unique regulatory profile .

  • Unlike sodA (superoxide dismutase) which shows increased expression in metal-contaminated environments, htpX in Pseudomonas showed more variable expression patterns, with lower copy numbers at highly contaminated sites compared to reference sites .

For Xanthomonas, investigations should examine htpX expression under various stressors (temperature shifts, oxidative stress, osmotic stress) using qRT-PCR or reporter constructs. Additionally, phenotypic characterization of ΔhtpX mutants under stress conditions could reveal functional roles in stress adaptation.

How might HtpX contribute to Xanthomonas virulence and host-pathogen interactions?

The potential role of HtpX in Xanthomonas virulence could be explored through:

  • Construction of clean deletion mutants: Create ΔhtpX strains and assess virulence in appropriate plant infection models.

  • Complementation studies: Confirm phenotypes through genetic complementation with wild-type and mutant htpX variants.

  • Tissue-specific expression analysis: Monitor htpX expression during different stages of infection.

  • Interaction with T3SS: Investigate potential functional connections between membrane protein quality control (HtpX) and the HrpG/HrpX-regulated T3SS machinery .

The relationship between HtpX protease and the HrpG/HrpX regulatory system is particularly intriguing. While they are distinct systems, their potential functional interplay during host infection deserves investigation, as proper membrane protein folding may be crucial for T3SS assembly and function.

What genetic tools are most appropriate for studying htpX function in Xanthomonas?

Effective genetic manipulation of htpX in Xanthomonas should employ:

  • Clean deletion approaches: Using suicide vectors with counter-selection markers to create markerless deletions.

  • Complementation constructs: Reintroducing htpX under native or inducible promoters.

  • Site-directed mutagenesis: Creating catalytic site mutations (in the HEXXH motif) to distinguish between proteolytic and structural functions.

  • Reporter fusions: Constructing transcriptional and translational fusions to monitor expression patterns.

For studying regulatory patterns, tools that enable examination of the htpX promoter region and potential regulatory elements are essential. This is particularly important given the evidence that homologous genes can have different regulatory patterns across bacterial species .

What approaches can be used to determine the membrane topology of Xanthomonas HtpX?

Determining the exact membrane topology of HtpX requires multiple complementary techniques:

  • Fusion reporter approaches: Creating systematic fusions with reporters like PhoA (active in periplasm) and GFP (active in cytoplasm) to map domain localization.

  • Cysteine accessibility methods: Introducing cysteine residues at various positions and assessing their accessibility to membrane-impermeable labeling reagents.

  • Protease protection assays: Using selective proteolysis of spheroplast preparations to identify protected domains.

  • Computational prediction: Employing multiple topology prediction algorithms to guide experimental designs.

These approaches can resolve questions about whether all hydrophobic regions function as transmembrane segments or if some have alternative membrane associations, which remains controversial even for well-studied bacterial HtpX proteins .

How can crystallographic or structural studies of HtpX be approached?

Structural studies of membrane proteins like HtpX present significant challenges:

  • Construct optimization: Testing multiple constructs with various terminal truncations and loop modifications.

  • Detergent screening: Systematic evaluation of detergents for optimal stability and monodispersity.

  • Lipidic cubic phase crystallization: This method often succeeds where traditional vapor diffusion fails for membrane proteins.

  • Cryo-EM alternatives: For challenging targets, single-particle cryo-EM may provide structural insights without crystallization.

Given that no high-resolution structure exists for any bacterial HtpX homolog, successful structural characterization would represent a significant breakthrough. Initial focus on the soluble catalytic domain might provide a more tractable target while still yielding valuable mechanistic insights.

How conserved is HtpX across Xanthomonas species and related bacterial pathogens?

Analysis of HtpX conservation across bacterial species reveals:

  • High conservation of catalytic domains: The HEXXH motif and surrounding catalytic machinery show strong conservation.

  • Variable regulatory elements: Promoter regions and regulatory elements may show significant divergence, suggesting different expression patterns .

  • Selective pressure patterns: Examining dN/dS ratios across the protein can identify regions under selective pressure.

The variation in regulatory elements is particularly notable, as even closely related Xanthomonas species can show significant differences in intergenic regions controlling gene expression . This suggests that while the catalytic function may be conserved, the conditions under which HtpX is expressed could vary significantly between species, potentially reflecting adaptation to different hosts or environmental niches.

What is the relationship between HtpX and other quality control proteases in Xanthomonas?

HtpX likely functions within a broader network of quality control proteases including:

  • FtsH (HflB): Another membrane-bound protease that often works coordinately with HtpX.

  • Cytoplasmic proteases: Clp, Lon, and other proteases may process substrates released by initial HtpX cleavage.

  • Periplasmic proteases: DegP and related proteases may handle misfolded proteins in other cellular compartments.

Studying genetic interactions through construction of double mutants could reveal functional redundancy or cooperation between these proteolytic systems. Additionally, comparing substrate profiles might illuminate the division of labor between different proteases in maintaining membrane protein quality.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.