Recombinant Xanthomonas axonopodis pv. citri Undecaprenyl-diphosphatase (uppP)

What is Undecaprenyl-diphosphatase (uppP) and why is it significant in Xanthomonas axonopodis pv. citri?

Undecaprenyl-diphosphatase (uppP), also known as Bacitracin resistance protein or Undecaprenyl pyrophosphate phosphatase, is an essential enzyme in Xanthomonas axonopodis pv. citri with EC number 3.6.1.27 . The protein is encoded by the gene uppP (synonyms: bacA, upk) and is identified by the locus name XAC0203 in Xanthomonas axonopodis pv. citri strain 306 . This membrane-embedded enzyme plays a critical role in bacterial cell wall biosynthesis by recycling the lipid carrier undecaprenyl pyrophosphate back to undecaprenyl phosphate, which is essential for peptidoglycan synthesis. The significance of uppP lies in its fundamental role in bacterial survival and its contribution to antibiotic resistance mechanisms, particularly against antibiotics that target cell wall synthesis. In Xanthomonas pathogens that cause citrus diseases, cell wall integrity is crucial for pathogenicity and environmental persistence, making uppP an important protein for understanding bacterial pathophysiology.

How does the uppP enzyme from X. axonopodis pv. citri differ structurally from other bacterial phosphatases?

The uppP enzyme from Xanthomonas axonopodis pv. citri possesses a distinctive structure optimized for its function in phosphate cleavage from undecaprenyl pyrophosphate. The protein consists of 265 amino acids with a molecular structure dominated by transmembrane domains, as evidenced by its hydrophobic amino acid composition . Based on the amino acid sequence (MSDLISALLLGILEGLTEFLPISSTGHLLIAEQWLGRRSDFFNIVIQAGAILAICLALRQRLWSLATGLGERANRDYVLKVGVAFLVTAVVGLIVRKAGWQLPETLQPVAWALLIGGVWMLVAEHFAGKLPERDVVTWKVAIAVGLAQVVAGVFPGTSRSASTIFIAMLLGLSKRSAAADFVFMVGIPTMFAASGYALLEMYKEGGFGTENWADVAVAFVAATITGFVVVKWLLGYIKKHRFTVFAVYRALLGAALLLWLPAAAG), the protein likely contains multiple membrane-spanning regions . Unlike cytoplasmic phosphatases, uppP is anchored within the bacterial membrane, positioning its active site to access membrane-embedded substrates. This structural arrangement distinguishes it from soluble phosphatases and reflects its specialized function in recycling membrane-bound lipid carriers. The enzyme's structure appears conserved among Xanthomonas species, suggesting evolutionary pressure to maintain this essential function in bacterial cell wall synthesis pathways.

What expression systems are most effective for recombinant production of X. axonopodis pv. citri uppP?

For recombinant production of X. axonopodis pv. citri uppP, E. coli-based expression systems offer the most practical approach due to their established protocols and high yield potential. Given that uppP is a membrane protein with multiple transmembrane domains, specialized E. coli strains such as C41(DE3) or C43(DE3), which are engineered for membrane protein expression, should be prioritized over standard BL21(DE3) strains. The uppP gene should be cloned into vectors containing moderately strong inducible promoters like pET or pBAD series, rather than constitutive or very strong promoters, to prevent toxicity from membrane protein overexpression. Expression should be conducted at lower temperatures (16-20°C) following induction with reduced inducer concentrations to facilitate proper membrane insertion and folding. Alternatively, cell-free expression systems supplemented with lipid nanodiscs or detergent micelles can be employed for difficult-to-express membrane proteins, providing a controlled environment that mimics the natural membrane setting while avoiding potential toxicity to host cells.

What purification strategies yield the highest quality recombinant uppP protein?

Purification of recombinant uppP requires specialized protocols that maintain the integrity of this membrane protein. Initially, bacterial cells should be disrupted using gentle methods such as enzymatic lysis with lysozyme or pressure-based disruption, rather than sonication which can destabilize membrane proteins. Membrane fractions should be isolated through differential centrifugation followed by solubilization using detergents like n-dodecyl β-D-maltoside (DDM), CHAPSO, or digitonin, which effectively extract membrane proteins while preserving native structure. Affinity chromatography, typically utilizing a poly-histidine tag fused to uppP, serves as the primary purification step, ideally performed at 4°C to minimize protein degradation. Size exclusion chromatography (SEC) as a final polishing step separates monomeric protein from aggregates and removes residual contaminants. Throughout the purification process, a consistent detergent concentration must be maintained in all buffers to prevent protein aggregation. For functional studies, reconstitution into lipid nanodiscs or proteoliposomes following purification may be necessary to restore the native-like membrane environment required for enzymatic activity.

How can researchers verify the enzymatic activity of recombinant uppP?

Verifying the enzymatic activity of recombinant uppP requires specialized assays that account for its membrane-associated function. A radiometric assay using 32P-labeled undecaprenyl pyrophosphate substrate offers the most direct approach, measuring the release of inorganic phosphate as uppP hydrolyzes the substrate. Alternatively, a coupled enzyme assay can be employed, linking phosphate release to a colorimetric reaction through enzymes such as purine nucleoside phosphorylase and a chromogenic substrate like 2-amino-6-mercapto-7-methylpurine riboside. For greater sensitivity, fluorescence-based assays utilizing fluorescently labeled phosphate-binding proteins can detect phosphate release at nanomolar concentrations. Researchers should include appropriate controls in all activity assays, including heat-inactivated enzyme and known phosphatase inhibitors, to verify specificity. Kinetic parameters (Km, Vmax) should be determined under varying substrate concentrations, and the influence of divalent cations (Mg2+, Mn2+) and pH on enzyme activity should be systematically evaluated to characterize the optimal conditions for uppP function, providing valuable insight into its biochemical properties.

What are the key structural domains of uppP and their roles in enzyme function?

The uppP protein from X. axonopodis pv. citri contains several distinct structural domains that coordinate its enzymatic activity within the bacterial membrane. Sequence analysis reveals a 265-amino acid protein with multiple hydrophobic regions that form transmembrane domains, allowing the protein to embed within the bacterial membrane . The catalytic domain likely contains conserved residues responsible for phosphatase activity, positioned to access the undecaprenyl pyrophosphate substrate at the membrane interface. While specific crystal structures for X. axonopodis pv. citri uppP are not available, homology modeling based on related bacterial phosphatases suggests that the protein adopts a multi-pass transmembrane configuration with cytoplasmic and periplasmic loops containing essential catalytic residues. The transmembrane domains not only anchor the protein but also create a hydrophobic environment suitable for binding the lipid substrate. The active site likely includes conserved motifs that coordinate essential metal ions required for phosphate hydrolysis, while other structural elements may regulate substrate access or product release through conformational changes during the catalytic cycle.

How does uppP contribute to antibiotic resistance mechanisms?

Undecaprenyl-diphosphatase (uppP) contributes significantly to antibiotic resistance in Xanthomonas axonopodis pv. citri through several mechanisms directly related to its enzymatic function. The protein is also known as Bacitracin resistance protein, highlighting its role in protecting bacteria against this antibiotic . Bacitracin acts by binding to undecaprenyl pyrophosphate, blocking its recycling and consequently inhibiting cell wall synthesis. By rapidly dephosphorylating undecaprenyl pyrophosphate, uppP reduces the concentration of bacitracin's target molecule, effectively bypassing the antibiotic's inhibitory effect. Additionally, uppP's activity maintains the pool of undecaprenyl phosphate needed for cell wall synthesis, allowing bacteria to continue producing peptidoglycan even in the presence of antibiotics that target other steps in this pathway. In Xanthomonas species, uppP likely contributes to the bacteria's ability to withstand environmental stresses and antibiotic challenges during plant infection. The importance of cell envelope integrity in pathogenesis suggests that uppP may indirectly influence virulence by ensuring robust cell wall synthesis during host colonization and infection progression.

What comparative approaches reveal functional differences between uppP in X. axonopodis pv. citri and other Xanthomonas species?

Comparative genomic and functional analyses provide crucial insights into the functional differences of uppP across Xanthomonas species. Sequence alignment of uppP from X. axonopodis pv. citri against homologs from X. axonopodis pv. citrumelo and X. campestris pv. vesicatoria reveals conservation patterns that highlight residues under selective pressure, potentially indicating functional importance . Domain architecture comparison between these species identifies regions where selective pressures have driven divergent evolution, possibly reflecting adaptation to different host environments or antibiotic challenges. Expression profile analysis using RNA-seq data across different growth conditions and infection stages can reveal distinct regulatory patterns of uppP between species, suggesting functional specialization. Knockout studies in different Xanthomonas species, followed by phenotypic characterization including growth rate, antibiotic susceptibility, and virulence assays, directly demonstrate functional differences in vivo. Biochemical characterization of recombinant uppP from multiple species, examining parameters such as substrate specificity, kinetic properties, and inhibitor sensitivity, provides quantitative measures of functional divergence that can be correlated with genomic differences identified in comparative analysis.

How can site-directed mutagenesis be used to study critical residues in uppP function?

Site-directed mutagenesis offers a powerful approach to dissect the structure-function relationships within the uppP enzyme from X. axonopodis pv. citri. Researchers should begin by identifying candidate residues for mutation based on sequence conservation analysis across bacterial phosphatases, focusing on charged amino acids (aspartate, glutamate, histidine) that typically form the catalytic center of phosphatases. Conserved residues within the predicted transmembrane regions might be essential for substrate recognition or membrane positioning and should be systematically replaced with alanine or similar-sized amino acids with different chemical properties. The QuikChange mutagenesis protocol or Gibson Assembly can effectively introduce these mutations into the uppP gene within an expression vector. Following protein expression and purification, mutant variants should undergo comprehensive biochemical characterization including steady-state kinetics, thermal stability assessment, and substrate specificity profiling, comparing results against wild-type enzyme. In parallel, complementation assays in uppP-knockout bacterial strains can evaluate the in vivo significance of each mutation, particularly focusing on growth rate, cell morphology, and antibiotic resistance phenotypes. Combining these in vitro and in vivo approaches creates a comprehensive picture of how specific residues contribute to enzyme function, potentially identifying targets for inhibitor design.

What high-throughput screening approaches can identify potential inhibitors of uppP activity?

High-throughput screening (HTS) for uppP inhibitors requires specialized approaches that account for the membrane-associated nature of this enzyme. Researchers should develop a robust biochemical assay that can detect uppP phosphatase activity in a microplate format, typically using colorimetric or fluorescent detection of released phosphate from a suitable substrate analog. Assay optimization should include determining the optimal detergent conditions that maintain enzyme stability while minimizing interference with detection systems. Primary screening can utilize diverse chemical libraries including natural product extracts, synthetic compound collections, and focused libraries of known phosphatase inhibitors at a single concentration (typically 10-20 μM). Hit compounds showing >50% inhibition should proceed to dose-response analysis to determine IC50 values and establish structure-activity relationships. Counter-screening against unrelated phosphatases helps identify selective inhibitors versus general phosphatase inhibitors. Biophysical methods including thermal shift assays, surface plasmon resonance, and isothermal titration calorimetry can confirm direct binding to uppP and determine binding kinetics. Lead compounds should undergo evaluation in bacterial growth inhibition assays against X. axonopodis pv. citri and other plant pathogens to establish antimicrobial activity, while cytotoxicity testing against plant and mammalian cells assesses safety profiles for potential agricultural applications.

How can CRISPR-Cas9 genome editing be applied to study uppP function in Xanthomonas?

CRISPR-Cas9 genome editing provides a sophisticated approach to investigate uppP function directly in Xanthomonas species. When designing a CRISPR-Cas9 system for Xanthomonas, researchers should construct a plasmid containing the Cas9 nuclease under control of a promoter functional in Xanthomonas (such as the constitutive lac promoter or inducible xylS promoter) along with a guide RNA targeting the uppP gene. The guide RNA should be designed using algorithms that minimize off-target effects while maximizing on-target efficiency, targeting early coding regions of the uppP gene to ensure complete loss of function. For precise gene modifications, a homology-directed repair template containing the desired mutation flanked by ~500 bp homology arms should be included. The CRISPR components can be delivered via conjugation using helper E. coli strains or electroporation of purified plasmids into competent Xanthomonas cells. Following transformation, edited colonies should be screened using PCR amplification and sequencing of the target region, with successful mutants subjected to comprehensive phenotypic analysis including growth curves in various media, cell morphology examination, antibiotic susceptibility testing (particularly to bacitracin), and virulence assessment on appropriate citrus hosts. Complementation experiments, reintroducing wild-type or modified uppP genes, can confirm phenotype specificity and rule out polar effects on neighboring genes.

How can recombinant uppP be used in screening for novel agricultural antimicrobials?

Recombinant uppP from X. axonopodis pv. citri offers a valuable platform for screening agricultural antimicrobial compounds targeting citrus canker disease. Researchers should first establish a robust in vitro assay system using purified recombinant uppP in a detergent-solubilized state or reconstituted into nanodiscs, with activity measured through phosphate release from undecaprenyl pyrophosphate or synthetic analogs. The screening platform should be adapted to a medium-throughput format using 96-well plates with colorimetric or fluorescent detection methods to enable testing of diverse compound libraries. Natural product extracts from plants, soil microbes, and marine organisms offer promising sources of novel inhibitors and should be prioritized alongside synthetic compound libraries. Virtual screening approaches using homology models of uppP can predict binding compounds and enhance the efficiency of physical screening efforts. Lead compounds identified from screens should be validated through dose-response studies, binding affinity measurements, and mechanism of action studies to distinguish competitive, non-competitive, and allosteric inhibitors. The most promising candidates should advance to whole-cell assays against X. axonopodis pv. citri, assessing growth inhibition and bactericidal activity while monitoring the development of resistance. Field-relevant assays including leaf-disc infection models and greenhouse studies with citrus seedlings provide critical validation before progressing to field trials, with successful compounds potentially providing new options for controlling citrus canker while reducing reliance on copper-based bactericides currently used in management practices .

What approaches can determine if uppP contributes to copper resistance in Xanthomonas citri strains?

Investigating the potential role of uppP in copper resistance requires multiple complementary approaches targeting different aspects of bacterial physiology and genetics. Researchers should begin by analyzing the correlation between uppP sequence variants or expression levels and copper resistance phenotypes across a diverse collection of X. citri strains with documented copper susceptibility or resistance profiles . Genetic manipulation through creation of uppP knockout mutants and complemented strains allows direct testing of uppP's contribution to copper tolerance when exposed to various copper concentrations in laboratory media. Transcriptional analysis using qRT-PCR or RNA-seq comparing uppP expression levels in copper-resistant versus susceptible strains, both basally and following copper exposure, can reveal if uppP is transcriptionally regulated in response to copper stress. Protein interaction studies using pull-down assays or bacterial two-hybrid systems may identify physical interactions between uppP and known copper resistance proteins such as those encoded by the cop operon, which has been associated with copper resistance in Xanthomonas strains from Réunion . Structural studies examining if copper ions directly bind to or inhibit uppP activity could reveal a direct mechanism for copper interaction. Membrane composition analysis in wild-type versus uppP mutant strains following copper exposure might demonstrate whether uppP indirectly contributes to copper resistance by modifying cell envelope properties, potentially reducing copper entry or enhancing efflux mechanisms.

How can uppP be utilized in understanding differences in pathogenicity between Xanthomonas species on citrus hosts?

Investigating uppP's role in differential pathogenicity among Xanthomonas species requires integrated approaches combining molecular genetics, biochemistry, and plant pathology. Researchers should perform comparative analysis of uppP sequence, structure, and enzymatic activity between highly virulent X. axonopodis pv. citri and less virulent X. axonopodis pv. citrumelo to identify species-specific variations that might correlate with different pathogenicity patterns on citrus hosts . Cross-species complementation experiments, introducing the uppP gene from X. axonopodis pv. citri into X. axonopodis pv. citrumelo (and vice versa), can directly test whether uppP contributes to the observed differences in host range and virulence between these closely related pathogens. Time-course expression analysis of uppP during infection of various citrus cultivars may reveal differential regulation patterns that correlate with successful colonization versus restricted growth. Cell wall composition analysis in wild-type and uppP-modified strains can determine if uppP-mediated changes to the bacterial cell envelope affect recognition by plant immune receptors or sensitivity to plant antimicrobial compounds, potentially explaining host range differences. Co-infection experiments with fluorescently labeled bacteria carrying different uppP variants can visually track competitive fitness during infection, revealing subtle advantages conferred by specific uppP alleles. Integration of these findings with broader genomic comparisons between X. axonopodis pv. citri and X. axonopodis pv. citrumelo, particularly focusing on type III effectors and other virulence factors, will place uppP's contribution within the larger context of pathogenicity determinants that differentiate these citrus pathogens .