Recombinant Xanthomonas axonopodis pv. citri UPF0060 membrane protein XAC3064 (XAC3064)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If a specific tag type is required, please inform us; we will prioritize its development.
Synonyms
XAC3064; UPF0060 membrane protein XAC3064
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-111
Protein Length
full length protein
Species
Xanthomonas axonopodis pv. citri (strain 306)
Target Names
XAC3064
Target Protein Sequence
MTIAPTTLLLFAATALAELVGCYLPYLWLRKGGSVWLLLPTALSLAVFVWLLSLHPEASG RVYAAYGGVYIASALLWLWWVDGVTPTRWDLLGAACCLLGMAVIMFSPRSA
Uniprot No.

Target Background

Database Links

KEGG: xac:XAC3064

STRING: 190486.XAC3064

Protein Families
UPF0060 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is XAC3064 and what functional role does it play in Xanthomonas axonopodis pv. citri?

XAC3064 is a UPF0060 family membrane protein found in Xanthomonas axonopodis pv. citri, the bacterial pathogen responsible for citrus canker disease. While the specific function of XAC3064 has not been fully characterized, it belongs to a family of membrane proteins that may be involved in bacterial pathogenicity mechanisms. Similar to other membrane proteins in X. axonopodis, it likely contributes to the bacterium's ability to colonize host plants and may play a role in host-pathogen interactions . The protein is integral to the bacterial membrane structure, and understanding its function could provide insights into bacterial adaptation and infection strategies in citrus plants.

How does XAC3064 compare structurally to other characterized membrane proteins in Xanthomonas species?

XAC3064 shares structural features with other membrane proteins found in Xanthomonas species, particularly in terms of transmembrane domains and potential functional motifs. When analyzing membrane protein structures, researchers typically examine:

  • Transmembrane topology predictions

  • Conserved protein domains

  • Structural motifs essential for function

  • Predicted protein-protein interaction sites

Based on comparative analysis with other Xanthomonas membrane proteins like those examined in pathogenicity studies, XAC3064 likely contains specific structural elements that determine its localization and function within the bacterial membrane . Similar to proteins such as AvrXacE1 and AvrXacE2, which have been studied for their roles in pathogenicity, XAC3064's structure may contain domains that facilitate interactions with both bacterial and host plant proteins.

What expression systems are most effective for recombinant production of XAC3064?

For recombinant production of XAC3064, several expression systems can be employed, each with specific advantages for membrane protein research:

Expression SystemAdvantagesLimitationsOptimization Strategies
E. coliHigh yields, rapid growth, well-established protocolsPotential improper folding of membrane proteinsUse specialized strains (C41/C43), lower induction temperatures (16-25°C)
Yeast (P. pastoris)Post-translational modifications, eukaryotic membrane environmentLonger production timeOptimize methanol induction protocol, use strong promoters
Insect cellsComplex protein folding capability, higher success with eukaryotic membrane proteinsHigher cost, more complex maintenanceOptimize MOI, harvest timing after infection
Cell-free systemsRapid expression, direct incorporation into artificial membranesLower yields, higher costSupplement with lipids and chaperones

The choice of expression system should be guided by the intended experimental applications. For structural studies using the vesicle-based method described in recent literature, E. coli expression systems may be particularly advantageous as they allow for direct vesicle preparation from the expression host, preserving the membrane protein in a native-like lipid environment .

How can the vesicle-based method be optimized for structural studies of XAC3064?

The vesicle-based method represents a significant advancement for studying membrane proteins in their native environment. For optimizing this method specifically for XAC3064 structural studies:

  • Expression optimization: Adjust expression conditions to ensure sufficient protein incorporation into membranes without toxicity to host cells.

  • Vesicle preparation: Modify the protocol described in recent literature by:

    • Optimizing lysozyme treatment conditions specific to Xanthomonas-derived proteins

    • Adjusting French press parameters to generate consistent inside-out vesicles

    • Implementing density gradient ultracentrifugation steps to enhance vesicle purity

  • Cryo-EM sample preparation optimization:

    • Use affinity-based approaches to enrich vesicles containing XAC3064

    • Implement Topaz-based deep learning particle picking for improved particle selection

    • Apply non-uniform refinement techniques to achieve higher resolution structures

  • Data processing considerations:

    • Implement symmetry-based refinement if XAC3064 forms oligomeric structures

    • Apply local refinement with appropriate masking to focus on protein regions

    • Compare structures with and without potential binding partners to identify conformational changes

This approach bypasses detergent screening and maintains the protein in its native lipid environment, potentially revealing structural features that might be altered in detergent-solubilized preparations .

What strategies can resolve contradictory data when comparing detergent-solubilized versus native membrane-embedded XAC3064 structures?

When faced with contradictory structural data between detergent-solubilized and membrane-embedded XAC3064 preparations, researchers should implement a systematic approach to resolution:

  • Comparative structural analysis:

    • Quantify differences in inter-domain distances, angles, and conformational states

    • Identify specific regions showing greatest variability between methods

    • Determine if differences are consistent with known detergent effects on membrane proteins

  • Functional validation experiments:

    • Design activity assays that can be performed in both detergent and membrane contexts

    • Correlate structural differences with functional outcomes

    • Use site-directed mutagenesis to probe the importance of regions showing variability

  • Molecular dynamics simulations:

    • Run parallel simulations of the protein in detergent micelles versus lipid bilayers

    • Analyze protein stability, dynamic motion, and conformational sampling

    • Identify energetically favorable conformations in each environment

  • Complementary biophysical techniques:

    • Compare results from multiple structural approaches (X-ray crystallography, NMR, SAXS, etc.)

    • Use hydrogen-deuterium exchange mass spectrometry to identify regions with different solvent accessibility

    • Apply cross-linking mass spectrometry to capture different conformational states

Similar to observations with AcrB trimers, which showed looser assembly in vesicles compared to detergent-solubilized structures , XAC3064 may exhibit physiologically relevant structural variations that reflect its true native state rather than methodological artifacts.

How can protein-protein interaction studies identify potential host targets of XAC3064 during infection?

To identify potential host targets of XAC3064 during infection, researchers can employ a multi-layered approach:

  • Yeast two-hybrid screening:

    • Use XAC3064 as bait against a Citrus sinensis cDNA library

    • Implement stringent screening conditions to reduce false positives

    • Validate primary interactions through targeted prey-bait confirmation assays

  • Co-immunoprecipitation coupled with mass spectrometry:

    • Express tagged XAC3064 in bacterial cells

    • Incubate with plant cell extracts under physiological conditions

    • Identify pulled-down host proteins through mass spectrometry analysis

  • Bimolecular fluorescence complementation (BiFC):

    • Construct fusion proteins of XAC3064 and candidate interactors

    • Express in plant protoplasts or through transient expression systems

    • Visualize interactions through reconstituted fluorescence

  • Proximity-dependent biotin labeling (BioID):

    • Create XAC3064-BioID fusion proteins

    • Express in infection models to label proximal proteins in vivo

    • Identify biotinylated proteins through streptavidin pulldown and mass spectrometry

This approach mirrors successful strategies used to identify interactions between other Xanthomonas effector proteins and host targets, which have revealed important mechanisms in pathogenicity . For XAC3064, these methods could uncover whether it interacts with host membrane proteins, signaling components, or immune system elements during the infection process.

What controls are essential when evaluating XAC3064 knockout effects on bacterial virulence?

When designing experiments to evaluate the effects of XAC3064 knockout on bacterial virulence, the following controls are essential:

Control TypePurposeImplementation
Wild-type strainBaseline virulence comparisonUse parental strain without genetic modifications
Complementation strainVerify phenotype due to targeted geneReintroduce XAC3064 on plasmid or genomic integration
Non-target knockoutControl for general knockout effectsKnockout gene of similar size but unrelated function
Vector-only controlControl for vector effects in complementationIntroduce empty vector into knockout strain
Positive controlValidate infection systemUse known virulence gene knockout with established phenotype
Multiple infection sitesControl for plant-specific variationUse multiple leaves/plants with randomized inoculation positions
Quantitative measurementsObjective assessment of virulenceMeasure lesion size, bacterial growth, and disease progression

Additionally, researchers should implement time-course experiments to capture the dynamics of infection, as some virulence factors may have stage-specific effects during pathogenesis. Similar experimental designs have been successfully employed to characterize the roles of AvrXacE1 and AvrXacE2 in X. axonopodis pathogenicity .

How can RNA-Seq data be leveraged to understand the regulatory network involving XAC3064?

RNA-Seq data can provide valuable insights into the regulatory network involving XAC3064 through a systematic analytical approach:

  • Differential expression analysis:

    • Compare transcriptomes of wild-type versus XAC3064 knockout strains

    • Identify genes with significant expression changes (typically using ≥2-fold change, p<0.05)

    • Analyze changes under different environmental conditions relevant to infection

  • Co-expression network construction:

    • Build gene correlation networks based on expression patterns

    • Identify gene clusters with similar expression profiles to XAC3064

    • Determine hub genes that may serve as master regulators

  • Transcription factor binding site analysis:

    • Examine promoter regions of differentially expressed genes

    • Identify enriched motifs that may indicate common regulatory mechanisms

    • Predict transcription factors that may regulate both XAC3064 and co-regulated genes

  • Integration with other omics data:

    • Combine RNA-Seq with ChIP-Seq to identify direct regulatory interactions

    • Correlate transcriptomic changes with proteomic and metabolomic alterations

    • Map transcriptional changes to known pathogenicity pathways

  • Validation experiments:

    • Confirm key regulatory relationships using reporter gene assays

    • Perform targeted gene knockouts of predicted regulatory factors

    • Use qRT-PCR to validate expression changes for selected genes

This approach can reveal whether XAC3064 functions within known virulence pathways or represents a novel virulence mechanism, similar to analyses conducted for other Xanthomonas pathogenicity factors .

What are the most effective protocols for purifying native XAC3064 while preserving its functional state?

For purifying native XAC3064 while preserving its functional state, researchers should consider the vesicle-based approach with modifications specific to this protein:

  • Bacterial culture preparation:

    • Grow Xanthomonas axonopodis pv. citri under optimal conditions

    • Induce protein expression if using recombinant systems

    • Harvest cells at mid-log phase to ensure membrane integrity

  • Vesicle generation protocol:

    • Treat harvested cells with lysozyme to break cell walls (typically 0.1-0.2 mg/mL)

    • Apply French press treatment (15,000-20,000 psi) to facilitate inside-out vesicle formation

    • Remove soluble proteins and unbroken cells through differential centrifugation steps

  • Enrichment of XAC3064-containing vesicles:

    • Apply affinity chromatography using antibodies against XAC3064 or added tags

    • Implement density gradient ultracentrifugation to separate vesicle populations

    • Verify protein presence and orientation using protease protection assays

  • Functional assessment:

    • Develop specific activity assays based on predicted protein function

    • Monitor protein stability using intrinsic fluorescence or circular dichroism

    • Assess lipid interactions using fluorescence anisotropy or native mass spectrometry

This approach preserves the native lipid environment and bypasses detergent solubilization, which has been shown to significantly alter membrane protein structure and assembly, as demonstrated with the AcrB transporter .

How can cryo-electron microscopy be optimized for high-resolution structural analysis of XAC3064?

To optimize cryo-electron microscopy for high-resolution structural analysis of XAC3064:

  • Sample preparation optimization:

    • Implement GraFix technique to stabilize protein complexes

    • Test multiple grid types (Quantifoil, C-flat, UltrAuFoil) with varying hole sizes

    • Optimize blotting conditions to achieve ideal ice thickness

  • Data collection strategy:

    • Collect data using energy filters to improve signal-to-noise ratio

    • Implement beam-tilt correction for aberration correction

    • Use movie recording with dose fractionation (40-50 frames) to minimize beam damage effects

  • Image processing workflow:

    • Apply motion correction using MotionCor2 or similar algorithms

    • Estimate defocus accurately using CTF estimation programs (CTFFIND4, Gctf)

    • Implement Topaz deep learning-based particle picking to accurately identify protein particles

  • 3D reconstruction optimization:

    • Apply non-uniform refinement techniques to account for conformational heterogeneity

    • Implement focused classification to resolve dynamic regions

    • Use local refinement with appropriate masking to maximize resolution of interest areas

  • Model building and validation:

    • Generate initial models using available homology structures or ab initio approaches

    • Refine models with real-space refinement in PHENIX or similar software

    • Validate models using MolProbity and EMRinger scores

This approach aligns with recent advances in membrane protein structural biology and builds upon successful strategies for other challenging membrane proteins, such as the AcrB trimer studied in vesicles .

What methods can determine if XAC3064 contributes to bacterial pathogenicity through interactions with host membrane proteins?

To determine if XAC3064 contributes to bacterial pathogenicity through interactions with host membrane proteins, researchers should employ a combination of approaches:

  • Gene knockout and complementation studies:

    • Create XAC3064 deletion mutants using CRISPR-Cas or homologous recombination

    • Assess virulence phenotypes in plant infection models

    • Complement mutants with wild-type and modified versions to map functional domains

  • Subcellular localization during infection:

    • Create fluorescently tagged XAC3064 constructs

    • Track protein localization during different infection stages

    • Use co-localization studies with known host membrane markers

  • In vitro membrane protein interaction assays:

    • Develop liposome-based binding assays with purified host membrane proteins

    • Implement surface plasmon resonance (SPR) with reconstituted membrane proteins

    • Use microscale thermophoresis to quantify binding affinities and kinetics

  • Direct infection model analysis:

    • Create transgenic plants expressing potential host targets with modifications

    • Assess infection outcomes when host targets are altered

    • Implement transcriptomic analysis of host response to wild-type versus XAC3064 mutants

  • Structural analysis of protein-protein complexes:

    • Use the vesicle-based approach to isolate complexes for cryo-EM analysis

    • Implement crosslinking mass spectrometry to identify interaction interfaces

    • Validate key interactions through mutagenesis of predicted interface residues

This integrated approach parallels successful strategies used to characterize other Xanthomonas effector proteins, such as AvrXacE1 and AvrXacE2, which were found to contribute to bacterial pathogenicity through specific interactions with host proteins .

How should researchers interpret differences in XAC3064 structure between in vitro and in vivo conditions?

When interpreting differences in XAC3064 structure between in vitro and in vivo conditions:

  • Contextual analysis framework:

    • Consider the lipid composition differences between artificial and native membranes

    • Evaluate potential effects of cellular crowding on protein conformation

    • Assess the impact of interacting partners present only in vivo

  • Functional correlation approach:

    • Determine if structural differences correlate with altered functional parameters

    • Design experiments to test if specific conformational states are activity-dependent

    • Evaluate whether observed differences represent physiologically relevant states or artifacts

  • Evolutionary conservation assessment:

    • Compare conformational variability across homologous proteins in related species

    • Identify if flexible regions correspond to species-specific adaptations

    • Determine if conserved structural elements maintain similar conformations regardless of environment

  • Molecular dynamics validation:

    • Perform simulations in different membrane environments to assess conformational stability

    • Calculate energy landscapes to identify preferred conformational states

    • Validate if observed structural differences represent energy minima under different conditions

Recent research on membrane proteins has shown that structures determined in detergent environments may exhibit significant differences compared to those in native membranes. For instance, the AcrB trimer showed looser assembly in vesicles compared to detergent-solubilized structures , highlighting the importance of considering membrane environment when interpreting structural data.

What statistical approaches are most appropriate for analyzing XAC3064 mutant phenotypes in infection models?

For analyzing XAC3064 mutant phenotypes in infection models, the following statistical approaches are most appropriate:

Statistical MethodApplicationAdvantagesKey Parameters
ANOVA with post-hoc testsCompare multiple strains/conditionsIdentifies significant differences between multiple groupsF-statistic, p-value, effect size (η²)
Linear mixed-effects modelsAccount for plant-to-plant variationControls for random effects like individual plant resistanceFixed effects, random effects, AIC/BIC
Survival analysisTime-to-symptom developmentHandles time-dependent phenomena and censored dataHazard ratio, Kaplan-Meier curves
Repeated measures ANOVATrack disease progression over timeAccounts for temporal correlation in measurementsTime×treatment interaction, Mauchly's test
Non-parametric testsWhen data violates normality assumptionsRobust to outliers and non-normal distributionsMann-Whitney U, Kruskal-Wallis H
Multivariate analysisIntegrate multiple phenotypic measurementsCaptures relationships between different disease parametersMANOVA, principal component analysis

Additionally, researchers should:

  • Determine appropriate sample sizes through power analysis before experiments

  • Implement randomization in experimental design to minimize bias

  • Use multiple biological replicates (minimum n=3, preferably n≥5)

  • Apply appropriate multiple testing corrections (e.g., Bonferroni, FDR)

  • Report effect sizes alongside p-values to indicate biological significance

These approaches allow for robust analysis of phenotypic data, similar to statistical methods employed in studies of other Xanthomonas virulence factors .

What are the most promising future research directions for understanding XAC3064 function in bacterial pathogenesis?

The most promising future research directions for understanding XAC3064 function in bacterial pathogenesis include:

  • Integrated structural-functional analysis:

    • Combining vesicle-based structural studies with in vivo functional assays

    • Mapping conformational changes during different stages of infection

    • Correlating structural motifs with specific pathogenicity mechanisms

  • Host-pathogen interaction network mapping:

    • Implementing systems biology approaches to position XAC3064 within broader virulence networks

    • Identifying host targets and signaling pathways affected by XAC3064

    • Determining epistatic relationships with other virulence factors

  • Comparative genomics and evolution:

    • Analyzing XAC3064 homologs across Xanthomonas species with different host ranges

    • Identifying natural variants and their correlation with virulence phenotypes

    • Tracking evolutionary patterns to understand selection pressures on this protein

  • Therapeutic targeting strategies:

    • Developing small molecule inhibitors based on structural insights

    • Designing peptide-based approaches to disrupt key protein-protein interactions

    • Engineering resistant plant varieties through modification of host targets

  • Advanced imaging applications:

    • Implementing super-resolution microscopy to track XAC3064 during infection

    • Using correlative light and electron microscopy to visualize host membrane alterations

    • Developing biosensors to monitor XAC3064 activity in real-time

These directions build upon successful approaches used to characterize other membrane proteins and bacterial virulence factors , while implementing cutting-edge technologies to address the specific challenges associated with understanding XAC3064 function in the context of plant pathogenesis.

How can researchers integrate structural biology and genetic approaches to develop comprehensive models of XAC3064 function?

To integrate structural biology and genetic approaches for developing comprehensive models of XAC3064 function:

  • Structure-guided mutagenesis pipeline:

    • Use high-resolution structures from vesicle-based cryo-EM approaches to identify key functional domains

    • Design targeted mutations of specific residues predicted to be important for function

    • Assess mutant phenotypes in both in vitro biochemical assays and in planta infection models

  • Domain swap experiments:

    • Create chimeric proteins between XAC3064 and related proteins with known functions

    • Test functionality of chimeras to map domain-specific activities

    • Correlate functional outcomes with structural features

  • Suppressor mutation analysis:

    • Identify secondary mutations that restore function in XAC3064 mutants

    • Map intramolecular and intermolecular interaction networks

    • Use network analysis to predict functional relationships

  • Computational modeling integration:

    • Develop molecular dynamics simulations informed by experimental structures

    • Predict conformational changes associated with different functional states

    • Generate testable hypotheses about allosteric regulation mechanisms

  • Temporal and spatial regulation analysis:

    • Combine structural information with transcriptomic and proteomic data

    • Map expression patterns to specific infection stages

    • Correlate structural states with temporal activation patterns

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.