Recombinant Xanthomonas campestris pv. campestris Biopolymer transport protein exbB (exbB)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
exbB; xcc-b100_0009; Biopolymer transport protein ExbB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-253
Protein Length
full length protein
Species
Xanthomonas campestris pv. campestris (strain B100)
Target Names
exbB
Target Protein Sequence
MLQEFVIAAAAGGSNPSAALSQMGFEHLITEMTSSPGDFAVSWVVLITLIAMSAASWYWT VINIFRATRLKSAADRVTTAFWDAPNAQDAIRAMEEQPASEPFSKIALDAAQAAAHHQRA EGSTGGMGESLSRSEFVDRALRQAVTRESTKLQSGMTLLATVGATAPFVGLLGTVWGIYG ALIKIGATGSASIDAVAGPVGEALIMTAIGLFVAIPAVFAFNFFSKVNSSVIAKFDTFAH DLHDFFATGSRVR
Uniprot No.

Target Background

Function

ExbB is involved in TonB-dependent, energy-driven transport of various receptor-bound substrates. It protects ExbD from proteolytic degradation and functionally stabilizes TonB.

Database Links
Protein Families
ExbB/TolQ family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the basic structure of ExbB in Xanthomonas campestris pv. campestris?

ExbB in Xanthomonas campestris pv. campestris (Xcc) is a transmembrane protein with three hydrophobic segments that anchor it to the cytoplasmic membrane . Hydropathy profile analysis using the Kyte and Doolittle algorithm reveals these distinct hydrophobic regions that form transmembrane domains . The protein's structure allows it to form complexes with other proteins in the TonB-ExbB-ExbD system, which is involved in energy transduction across the bacterial membrane.

ExbB can form both hexameric and pentameric complexes with ExbD, as revealed by X-ray crystallography and single particle cryo-electron microscopy studies . The cytoplasmic loop region of ExbB has been shown to form approximately 60 kDa complexes with other proteins . The protein also has the capacity to form homodimers of approximately 52 kDa, which have been identified through cross-linking studies .

How does the ExbB-ExbD-TonB system function in Xanthomonas compared to other gram-negative bacteria?

The ExbB-ExbD-TonB system in Xanthomonas campestris pv. campestris functions as an energy transduction complex that couples cytoplasmic membrane energy to outer membrane transport processes, particularly for iron acquisition.

In Xcc, the genetic organization of this system is unusual compared to other gram-negative bacteria, containing four open reading frames designated tonB, exbB, exbD1, and exbD2 . While tonB, exbB, and exbD1 are essential for ferric iron uptake in Xcc, exbD2 is not required . This differs from systems like those in E. coli where typically only one exbD gene is present.

Sequence homology analysis shows that Xcc ExbB shares 40.6% identity and 71.8% similarity with ExbB from Neisseria meningitidis . Similarly, ExbD1 and ExbD2 show 39.7% and 36.2% identity to N. meningitidis ExbD respectively . Lower sequence homology was also observed between Xcc ExbB and E. coli TolQ, as well as between Xcc ExbD1/ExbD2 and E. coli TolR .

What are the recommended methods for cloning and expressing recombinant ExbB from Xanthomonas campestris pv. campestris?

For successful cloning and expression of recombinant ExbB from Xanthomonas campestris pv. campestris, researchers should consider the following methodological approach:

  • DNA Fragment Isolation: Begin by isolating the ExbB gene from Xcc genomic DNA. Based on published methods, the exbB gene can be found in a 3.6-kb HindIII-SmaI DNA fragment . PCR amplification using primers designed from the known sequence (GenBank) is recommended.

  • Vector Selection: For initial cloning, vectors such as pSVB30 and pHGW31 have been successfully used for exbB cloning . For expression studies, consider using vectors with inducible promoters suitable for membrane protein expression.

  • Construct Validation: After cloning, sequence verification is essential to confirm the integrity of the exbB gene. Pay particular attention to the regions encoding the three hydrophobic segments.

  • Expression Conditions: When expressing ExbB, consider its nature as a membrane protein. Expression in E. coli BL21(DE3) at lower temperatures (16-20°C) after induction with reduced IPTG concentrations (0.1-0.5 mM) may improve proper folding and reduce formation of inclusion bodies.

  • Protein Extraction: Use gentle detergents suitable for membrane protein extraction, such as n-dodecyl-β-D-maltoside (DDM) or CHAPS, which have been effective in maintaining the structural integrity of ExbB complexes during purification.

  • Construct Design Considerations: For structural studies, consider creating fusion constructs with tags that facilitate purification while minimizing interference with function (e.g., His-tags at termini with TEV protease cleavage sites).

How can I create site-directed mutations in ExbB to study its functional domains?

To create site-directed mutations in ExbB for functional domain studies, follow these methodological steps:

  • Target Selection: Based on sequence alignments and structural information, identify conserved residues likely to be functionally important. Key regions to consider include:

    • The cytoplasmic loop region where ExbB forms the ~60 kDa complex with unknown proteins

    • Residues at positions analogous to S80, which has been shown to form cross-links when substituted with pBpa (p-benzoyl-L-phenylalanine)

    • The three hydrophobic transmembrane segments

  • Mutagenesis Method: Use site-directed mutagenesis techniques such as:

    • QuikChange method (Agilent) for single or multiple point mutations

    • Gibson Assembly for larger modifications or domain swapping

    • For unnatural amino acid incorporation (like pBpa), use amber suppression technology with modified tRNAs and aminoacyl-tRNA synthetases

  • Functional Validation: Test mutant constructs for:

    • Protein expression and membrane localization

    • Ability to form complexes with ExbD and TonB

    • Complement exbB-deficient strains in iron uptake assays

  • Cross-linking Studies: For interaction domain mapping, incorporate photo-crosslinkable amino acids like pBpa at specific positions (similar to the approach used in E. coli studies where ExbB S80(pBpa) formed specific cross-linked complexes) .

  • Structure-Function Correlation: Correlate mutation effects with the known structural information from hexameric and pentameric ExbB-ExbD complexes revealed by X-ray crystallography and cryo-EM .

What are the most effective methods for purifying recombinant ExbB protein while maintaining its native structure?

The purification of recombinant ExbB while preserving its native structure requires careful consideration of its membrane protein nature. Follow these methodological steps:

  • Membrane Fraction Isolation:

    • After cell lysis (preferably using gentle methods like enzymatic lysis with lysozyme followed by osmotic shock), separate membrane fractions through ultracentrifugation.

    • Wash membrane fractions with high-salt buffer (e.g., 300 mM NaCl) to remove peripheral membrane proteins.

  • Detergent Selection and Solubilization:

    • For initial solubilization, mild detergents such as n-dodecyl-β-D-maltoside (DDM) or CHAPS at concentrations just above their critical micelle concentration (CMC) are recommended.

    • Incubate membrane fractions with the selected detergent at 4°C with gentle rotation for 1-2 hours.

  • Affinity Chromatography:

    • If using His-tagged ExbB, purify using Ni-NTA affinity chromatography with detergent in all buffers.

    • Use imidazole gradient elution (20-250 mM) to minimize non-specific binding.

  • Size Exclusion Chromatography:

    • Further purify by size exclusion chromatography to separate different oligomeric states.

    • Based on reported structures, monitor for hexameric and pentameric complexes if co-expressing with ExbD .

  • Complex Stability Monitoring:

    • Analyze complex formation by blue native PAGE or analytical ultracentrifugation.

    • Monitor protein stability throughout purification using thermal shift assays.

  • Quality Control:

    • Assess protein homogeneity by dynamic light scattering.

    • Verify proper folding using circular dichroism spectroscopy, particularly to evaluate the alpha-helical content expected in transmembrane domains.

  • Storage Conditions:

    • Store purified ExbB in buffers containing 10-15% glycerol and appropriate detergent at concentrations slightly above CMC.

    • Flash-freeze small aliquots in liquid nitrogen for long-term storage.

What are the recommended approaches for studying ExbB-ExbD interactions in Xanthomonas campestris pv. campestris?

To study ExbB-ExbD interactions in Xanthomonas campestris pv. campestris effectively, consider these methodological approaches:

  • Co-expression Systems:

    • Design constructs for co-expression of ExbB with ExbD1 and/or ExbD2.

    • Consider dual expression vectors or co-transformation with compatible plasmids.

    • Use different affinity tags on each protein (e.g., His-tag on ExbB and Strep-tag on ExbD) to facilitate complex purification.

  • In vivo Crosslinking:

    • Utilize formaldehyde or photo-crosslinking approaches similar to those that identified ExbB homodimers (~52 kDa) and ExbB complexes with unknown proteins (~60 kDa) .

    • Consider site-specific incorporation of photo-crosslinkable amino acids at positions analogous to S80, S82, and S84 as studied in E. coli ExbB .

  • Cryo-EM Analysis:

    • Purify complexes in detergent micelles or reconstitute into nanodiscs for cryo-EM analysis.

    • Use approaches similar to those that revealed hexameric and pentameric ExbB-ExbD complexes in other systems .

    • Employ Bayesian-based algorithms like those implemented in RELION for 3D reconstruction .

  • Complex Composition Analysis:

    • Use analytical ultracentrifugation to determine stoichiometry of ExbB-ExbD1/ExbD2 complexes.

    • Compare with known ExbB₆-ExbD₃ and ExbB₅-ExbD₁ complexes identified in other systems .

  • Functional Reconstitution:

    • Reconstitute purified complexes into liposomes to study energy transduction functions.

    • Measure proton translocation or fluorescent probe responses to assess functionality.

  • Mutagenesis Studies:

    • Generate mutations in predicted interaction interfaces.

    • Create truncation mutants to identify minimal regions required for complex formation.

    • Design chimeric proteins with domains from ExbD1 and ExbD2 to understand the functional differences.

How does the structure of hexameric vs. pentameric ExbB-ExbD complexes influence their function?

The hexameric and pentameric organizations of ExbB-ExbD complexes represent distinct structural arrangements that likely influence function in different ways:

Hexameric Complex (ExbB₆-ExbD₃):

The hexameric complex consists of six ExbB subunits and three ExbD transmembrane domains (TMs) . In this arrangement, the ExbB subunits form a symmetrical hexamer that creates a central cavity where the three ExbD TMs are positioned. This structure has been determined through X-ray crystallography and cryo-EM at approximately 6.7 Å resolution .

The functional implications of this arrangement include:

  • The hexameric arrangement creates a larger central channel that may facilitate proton translocation.

  • The 6:3 stoichiometry suggests a functional unit where pairs of ExbB interact with single ExbD TMs.

  • The central positioning of ExbD TMs likely facilitates energy conversion from proton motive force to mechanical energy for TonB activation.

Pentameric Complex (ExbB₅-ExbD₁):

The pentameric complex consists of five ExbB subunits with a single ExbD TM in the center . This arrangement creates a smaller central cavity compared to the hexameric complex.

Functional implications include:

  • The more compact arrangement may represent a different functional state in the energy transduction cycle.

  • The 5:1 stoichiometry suggests a more direct coupling between the ExbB pentamer and a single ExbD.

  • This structure may represent an intermediate state during the energy transduction process.

Transitional Dynamics:

The existence of both hexameric and pentameric complexes suggests a dynamic interconversion that may be essential for the energy transduction mechanism. The transition between these states might represent different steps in the energy coupling process, where conformational changes drive mechanical energy transfer to TonB.

Based on cross-linking studies, ExbB can simultaneously interact with a second ExbB and an unknown protein, further supporting the dynamic nature of these complexes during the TonB-dependent energy transduction cycle .

What structural features distinguish ExbB in Xanthomonas from homologous proteins in other bacterial species?

ExbB in Xanthomonas campestris pv. campestris displays several distinct structural features when compared to homologous proteins in other bacterial species:

  • Sequence Homology Patterns:

    • Xcc ExbB shares 40.6% identity and 71.8% similarity with ExbB from Neisseria meningitidis .

    • It also shows homology to the E. coli TolQ protein, though to a lesser degree .

    • These homology patterns suggest structural conservation of key functional domains while allowing for species-specific adaptations.

  • Transmembrane Topology:

    • Hydropathy analysis indicates Xcc ExbB contains three hydrophobic segments that likely form transmembrane domains .

    • This three-transmembrane topology is conserved across ExbB proteins from different species, suggesting functional importance.

  • Genomic Context and Organization:

    • The tonB-exb region in Xcc has an unusual structure compared to other bacteria, with four open reading frames: tonB, exbB, exbD1, and exbD2 .

    • This organization differs from E. coli and many other gram-negative bacteria that typically have only one exbD gene.

    • The presence of two exbD genes (exbD1 and exbD2) is a distinguishing feature of Xcc, with only exbD1 being essential for iron uptake .

  • Protein-Protein Interaction Domains:

    • The cytoplasmic loop of ExbB forms specific interactions, including a ~60 kDa complex with unknown proteins .

    • Residues equivalent to S80 in E. coli ExbB appear to be crucial for interaction with other proteins, indicating conservation of key interaction sites across species .

  • Complex Formation Capabilities:

    • Like ExbB from other species, Xcc ExbB can form both hexameric and pentameric arrangements with ExbD proteins .

    • The ability to form homodimers (~52 kDa) is also conserved across species .

How does ExbB contribute to iron uptake and virulence in Xanthomonas campestris pv. campestris?

ExbB plays a critical role in iron uptake and virulence in Xanthomonas campestris pv. campestris through several mechanisms:

  • TonB-Dependent Energy Transduction:

    • ExbB, along with ExbD1 and TonB, forms an essential energy transduction complex that couples cytoplasmic membrane energy to outer membrane transport processes .

    • This system harnesses the proton motive force from the cytoplasmic membrane to energize TonB, which then activates outer membrane transporters involved in iron uptake.

  • Essentiality for Iron Acquisition:

    • Genetic studies have demonstrated that tonB, exbB, and exbD1 are all essential for ferric iron uptake in Xcc .

    • Interestingly, while exbD2 shows homology to exbD1, it is not required for iron uptake, suggesting functional specialization or redundancy .

  • Impact on Virulence:

    • Iron is an essential micronutrient and a limiting factor in plant-pathogen interactions.

    • By enabling efficient iron acquisition in the iron-limited host environment, ExbB indirectly contributes to bacterial virulence and successful host colonization.

    • Iron limitation is a common host defense mechanism, making efficient iron acquisition systems crucial virulence determinants.

  • Potential Linkage to Extracellular Polysaccharide Production:

    • While not directly shown for ExbB, the TonB-dependent transport systems in Xanthomonas are interconnected with production of extracellular polysaccharides (EPS) like xanthan gum .

    • These EPS components are important virulence factors involved in biofilm formation and host colonization .

    • Disruption of biofilm formation through various mechanisms has been shown to affect leaf surface colonization and disease development in Xanthomonas .

  • Regulatory Networks:

    • The expression of exbB likely responds to iron availability through regulatory systems similar to the Fur (ferric uptake regulator) system in other bacteria.

    • This regulation ensures appropriate expression of iron uptake systems only when needed, preventing toxic iron overload while enabling acquisition during limitation.

What are the recommended methods for assessing ExbB function in iron transport assays?

To effectively assess ExbB function in iron transport in Xanthomonas campestris pv. campestris, researchers should consider these methodological approaches:

  • Growth Under Iron Limitation:

    • Method: Culture wild-type, exbB mutant, and complemented strains in minimal media with iron chelators like 2,2'-dipyridyl or EDDA.

    • Assessment: Monitor growth curves using spectrophotometry (OD600) over 24-48 hours.

    • Controls: Include conditions with excess iron (FeCl3 supplementation) to demonstrate specificity of the phenotype to iron limitation.

  • Radioactive Iron (⁵⁵Fe) Uptake Assays:

    • Method: Expose bacteria to ⁵⁵Fe-labeled siderophores or ⁵⁵Fe-citrate complexes and measure cellular accumulation over time.

    • Assessment: Quantify internalized ⁵⁵Fe using scintillation counting.

    • Controls: Include competition with excess non-radioactive iron and use energy inhibitors to confirm active transport.

  • Siderophore Production and Utilization:

    • Detection: Use chrome azurol S (CAS) agar plates to visualize siderophore production (orange halos around colonies).

    • Quantification: Measure siderophore levels in culture supernatants using CAS liquid assay (spectrophotometric).

    • Cross-feeding: Test whether exbB mutants can utilize exogenous siderophores by monitoring growth restoration with spent media from wild-type cultures.

  • Genetic Complementation Studies:

    • Approach: Express wild-type exbB in trans in exbB knockout strains to confirm phenotype rescue.

    • Variations: Create point mutations in key residues to identify essential functional regions.

    • Controls: Include empty vector controls and complementation with homologous exbB genes from related species.

  • Gene Expression Analysis:

    • qRT-PCR: Measure expression of exbB and iron-regulated genes in wild-type and mutant backgrounds under different iron conditions.

    • Reporter Fusions: Create transcriptional fusions (e.g., exbB promoter::gfp) to monitor expression patterns.

    • RNA-Seq: Perform global transcriptomic analysis to identify regulatory networks affected by exbB mutation.

  • In planta Assays:

    • Inoculation Experiments: Assess virulence of wild-type, exbB mutant, and complemented strains on host plants.

    • Quantification: Measure bacterial population, lesion size, and symptom development over time.

    • Iron Supplementation: Test whether exogenous iron can partially rescue the virulence defects of exbB mutants.

How do the dual ExbD proteins (ExbD1 and ExbD2) in Xanthomonas campestris pv. campestris functionally differ and interact with ExbB?

The presence of two ExbD proteins (ExbD1 and ExbD2) in Xanthomonas campestris pv. campestris represents an intriguing deviation from the typical single ExbD found in most gram-negative bacteria. Their functional differentiation and interaction with ExbB can be analyzed as follows:

Functional Differences:

  • Iron Uptake Requirements:

    • ExbD1 is essential for ferric iron uptake in Xcc, while ExbD2 is not required for this function .

    • This clear functional distinction suggests either specialization of ExbD2 for other processes or functional redundancy where ExbD1 can compensate for ExbD2's absence.

  • Sequence Homology Patterns:

    • ExbD1 and ExbD2 show 39.7% and 36.2% identity to N. meningitidis ExbD respectively .

    • Both proteins also show homology to E. coli TolR, suggesting potential functional overlap with the Tol system .

    • The sequence divergence between ExbD1 and ExbD2 likely accounts for their functional differences.

  • Transmembrane Topology:

    • Both ExbD1 and ExbD2 contain one large hydrophobic segment each, based on hydropathy profiles .

    • This similar topology suggests conserved membrane anchoring mechanisms despite functional differences.

Interaction with ExbB:

  • Complex Formation:

    • Based on studies of similar systems, ExbB likely forms distinct complexes with ExbD1 and potentially ExbD2.

    • The hexameric ExbB complex can accommodate three ExbD transmembrane domains , suggesting potential for mixed complexes containing both ExbD1 and ExbD2.

  • Energy Transduction:

    • The ExbB-ExbD1 complex couples proton motive force to TonB activation for iron transport.

    • The ExbB-ExbD2 complex may couple energy to different processes or serve as a regulatory mechanism.

  • Evolutionary Implications:

    • The presence of dual ExbD proteins may represent an adaptation to the plant-associated lifestyle of Xcc, potentially allowing more nuanced responses to environmental conditions.

Proposed Functional Model:

FeatureExbD1ExbD2
Essential for iron uptakeYesNo
Interaction with ExbBConfirmedPresumed but not characterized
Complex stoichiometryForms part of ExbB₆-ExbD₃ or ExbB₅-ExbD₁Unknown
Potential alternative functionsPrimary role in iron acquisitionPossible role in alternative transport processes or stress responses
Sequence conservationHigher homology to characterized ExbD proteinsLower homology to characterized ExbD proteins

What experimental approaches would be most effective for resolving the atomic-level structure of the complete ExbB-ExbD-TonB complex in Xanthomonas?

Resolving the atomic-level structure of the complete ExbB-ExbD-TonB complex in Xanthomonas campestris pv. campestris presents significant challenges due to its membrane-embedded nature and dynamic conformational states. A comprehensive multi-technique approach would be most effective:

  • Cryo-Electron Microscopy (Cryo-EM):

    • Sample Preparation: Purify the complete complex in detergent micelles, amphipols, or reconstitute into nanodiscs to maintain native structure.

    • Data Collection: Use direct electron detectors and collect large datasets (>10,000 micrographs) to capture various conformational states.

    • Processing: Employ Bayesian-based algorithms like RELION for 3D reconstruction, with special attention to particle sorting to identify different oligomeric states and conformations.

    • Resolution Enhancement: Apply techniques like local refinement and particle subtraction to improve resolution of flexible regions.

  • X-ray Crystallography:

    • Crystallization Approaches: Screen lipidic cubic phase (LCP) and detergent-based crystallization methods.

    • Stabilization Strategies: Use antibody fragments (Fabs) or nanobodies to stabilize specific conformations and provide crystal contacts.

    • Data Collection: Utilize microfocus beamlines and collect multiple datasets for molecular replacement and phase determination.

    • Structure Solution: Combine with lower-resolution cryo-EM maps for molecular replacement and phase improvement.

  • Integrative Structural Biology:

    • Cross-linking Mass Spectrometry (XL-MS): Use chemical cross-linkers or photo-cross-linkable amino acids to identify interaction interfaces between complex components .

    • Hydrogen-Deuterium Exchange Mass Spectrometry (HDX-MS): Map solvent-accessible regions and conformational changes.

    • Small-Angle X-ray Scattering (SAXS): Obtain solution-state structural information to complement cryo-EM and crystallography.

    • Computational Integration: Use integrative modeling platforms to combine data from multiple experimental techniques.

  • Advanced Spectroscopic Methods:

    • Solid-State NMR: Characterize specific domains and interaction interfaces, particularly for transmembrane regions.

    • EPR Spectroscopy: Use site-directed spin labeling to measure distances between specific residues and track conformational changes.

    • Single-Molecule FRET: Monitor dynamic conformational changes and transient interactions in the complex.

  • Computational Approaches:

    • AlphaFold2/RoseTTAFold: Generate predicted structures for individual components and subcomplexes.

    • Molecular Dynamics: Simulate the behavior of the complex in a membrane environment to understand dynamic properties.

    • Model Validation: Verify computational models against experimental cross-linking and spectroscopic data.

  • Sample Optimization Strategies:

    • Construct Design: Create truncated constructs and stable subcomplexes to overcome flexibility issues.

    • Co-expression Systems: Develop polycistronic constructs for coordinated expression of all components.

    • Mutagenesis: Introduce mutations that stabilize specific conformational states while maintaining function.

How might understanding ExbB function contribute to developing targeted approaches for controlling Xanthomonas infections in crops?

Understanding ExbB function in Xanthomonas campestris pv. campestris offers several promising avenues for developing targeted approaches to control Xanthomonas infections in economically important crops:

  • Small Molecule Inhibitors:

    • Detailed structural knowledge of ExbB and its complexes enables structure-based drug design targeting specific functional sites.

    • Inhibitors that disrupt ExbB-ExbD interactions or prevent proper complex formation would compromise iron acquisition and virulence.

    • High-throughput screening of chemical libraries against purified ExbB or the ExbB-ExbD complex could identify lead compounds for agricultural antimicrobials with specificity for Xanthomonas.

  • Peptide-Based Inhibitors:

    • Peptides designed to mimic interaction interfaces between ExbB and its binding partners could act as competitive inhibitors.

    • Transmembrane peptide mimetics could disrupt the assembly of functional ExbB complexes in the bacterial membrane.

    • These approaches could be particularly effective as they target protein-protein interactions specific to the pathogen.

  • Host-Induced Gene Silencing (HIGS):

    • Transgenic plants expressing RNAi constructs targeting exbB mRNA could suppress pathogen virulence upon infection.

    • This approach would specifically target the pathogen while having minimal impact on beneficial microbiota.

  • CRISPR-Cas9 Based Antimicrobials:

    • CRISPR-Cas9 systems delivered by phage vectors could specifically target and disrupt the exbB gene in Xanthomonas populations.

    • This highly specific approach would avoid disrupting beneficial microbiome members.

  • Biocontrol Approaches:

    • Competitive microorganisms engineered to secrete ExbB-binding peptides or proteins could interfere with Xanthomonas iron acquisition in the plant environment.

    • Biocontrol agents with enhanced siderophore production could outcompete Xanthomonas for available iron.

  • Plant Resistance Engineering:

    • Plants could be engineered to express proteins that interfere with ExbB function when Xanthomonas infection is detected.

    • Alternatively, plants could be modified to enhance iron sequestration in response to infection, further limiting pathogen access to this essential nutrient.

  • Vaccine-Like Approaches:

    • Plants could be pretreated with inactivated ExbB protein or peptides to trigger defense responses before actual infection occurs.

    • This "immunization" approach could prime plant defense systems to respond more rapidly to subsequent Xanthomonas infections.

What are the current knowledge gaps and promising research directions for understanding ExbB function in Xanthomonas campestris pv. campestris?

Despite significant advances in understanding ExbB and the TonB-ExbB-ExbD system in Xanthomonas campestris pv. campestris, several knowledge gaps remain. Addressing these represents promising directions for future research:

  • Structural Dynamics and Energy Transduction Mechanism:

    • Knowledge Gap: The precise mechanism by which ExbB harnesses proton motive force and converts it to mechanical energy for TonB activation remains poorly understood.

    • Research Direction: Develop in vitro reconstitution systems in proteoliposomes with fluorescent probes to monitor proton flux and conformational changes simultaneously.

    • Approach: Combine high-speed atomic force microscopy with single-molecule FRET to visualize conformational dynamics in real-time.

  • ExbD1 vs. ExbD2 Functional Specialization:

    • Knowledge Gap: The specific function of ExbD2, which is not required for iron uptake unlike ExbD1, remains unknown .

    • Research Direction: Perform comparative transcriptomics and proteomics of wild-type, ΔexbD1, and ΔexbD2 mutants under various stress conditions.

    • Approach: Create reporter fusions to monitor exbD1 and exbD2 expression patterns in different microenvironments during plant infection.

  • Complete Interaction Network:

    • Knowledge Gap: The identity of the unknown protein forming a ~60 kDa complex with the ExbB cytoplasmic loop remains unresolved .

    • Research Direction: Use proximity-dependent biotinylation (BioID) or APEX2 approaches to identify proteins in close proximity to ExbB in vivo.

    • Approach: Perform systematic interactome analysis using affinity purification coupled with mass spectrometry.

  • Host-Specific Adaptations:

    • Knowledge Gap: How the ExbB-ExbD-TonB system in Xanthomonas has evolved specific adaptations for plant pathogenesis versus systems in animal pathogens.

    • Research Direction: Conduct comparative genomic and structural analyses across Xanthomonas species with different host ranges.

    • Approach: Perform functional complementation studies with exbB genes from diverse bacterial species to identify plant-specific functional determinants.

  • Regulatory Networks and Environmental Responses:

    • Knowledge Gap: The regulatory mechanisms controlling exbB expression in response to environmental cues beyond iron availability.

    • Research Direction: Map the complete regulatory network controlling exbB expression using ChIP-seq and RNA-seq under various environmental conditions.

    • Approach: Develop biosensor strains with fluorescent reporters to monitor exbB expression dynamics during plant colonization.

  • Potential for Novel Antimicrobial Targets:

    • Knowledge Gap: The druggability of the ExbB-ExbD interface and identification of specific inhibitor binding pockets.

    • Research Direction: Perform fragment-based screening and computational docking studies to identify potential binding sites.

    • Approach: Develop high-throughput screening assays to test compound libraries for inhibition of ExbB-ExbD complex formation or function.

Table: Promising Research Directions and Potential Methodologies

Research FocusKey Knowledge GapPromising MethodologiesExpected Impact
Structure-Function RelationshipAtomic-level details of energy transduction mechanismCryo-EM, HDX-MS, smFRETFundamental understanding of bioenergetic coupling
ExbD2 FunctionPhysiological role of ExbD2Comparative -omics, phenotypic microarraysInsight into specialized transport systems
Interaction PartnersIdentity of proteins forming complexes with ExbBBioID, cross-linking MS, interactomicsComplete model of the TonB-dependent transport system
Host AdaptationPlant-specific features of the ExbB-ExbD-TonB systemComparative genomics, functional complementationUnderstanding of host-pathogen co-evolution
Regulatory NetworksEnvironmental control of system expressionChIP-seq, RNA-seq, reporter studiesComprehensive view of system regulation during infection
Antimicrobial DevelopmentTargetable sites for inhibitor developmentFragment screening, in silico dockingNovel control strategies for Xanthomonas diseases

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.