Recombinant Xanthomonas campestris pv. campestris C4-dicarboxylate transport protein (dctA)

Shipped with Ice Packs
In Stock

Description

Protein Structure and Production

The recombinant dctA protein is expressed in E. coli as a His-tagged fusion protein. Key structural and production details include:

ParameterValueSource
UniProt IDQ8P5J5 or Q4UYH8 (strain-dependent)
Protein LengthFull-length (1–448 amino acids)
Molecular Weight~50 kDa (estimated)
TagN-terminal His tag
Purity>90% (SDS-PAGE verified)
Storage BufferTris/PBS-based buffer with 6% trehalose (pH 8.0)
ReconstitutionLyophilized powder resuspended in deionized water (0.1–1.0 mg/mL)

Amino Acid Sequence Highlights:
The protein contains conserved motifs for proton-coupled symport, including transmembrane domains and ion-binding residues (e.g., R, K, D) critical for substrate recognition .

Functional Mechanism

dctA belongs to the DASS family (Daughters against dSerine) and mediates proton-coupled symport of C4-dicarboxylates. Key functional attributes:

CharacteristicsDetailsSource
SubstratesSuccinate, fumarate, malate, oxaloacetate
Ion Coupling3+ H⁺ per substrate (electrogenic transport)
pH DependenceOptimal activity at neutral-alkaline pH (pH 7–8)
Temperature SensitivityActive at physiological temperatures (25–37°C)
AffinityHigh-affinity transport (millimolar concentrations)

Regulatory Interactions:

  • CRP-cAMP Complex: Represses dctA expression via competition with DctD for promoter binding .

  • DctB/DctD System: Activates dctA transcription in response to C4-dicarboxylates .

Transport Efficiency and Competition

In Pseudomonas aeruginosa, dctA operates as a high-affinity transporter (millimolar range) for succinate, while DctPQM (TRAP family) handles low-affinity transport (micromolar range) . This dual-system strategy optimizes substrate uptake under varying conditions.

Pathogenicity and Virulence

In X. campestris pv. campestris, dctA is linked to stomatal modulation during plant infection. Mutants lacking functional dctA show reduced virulence due to impaired nutrient acquisition .

Functional Studies

  • Membrane Vesicle Assays: Used to study substrate specificity and ion coupling .

  • Mutant Analysis: Disruption of dctA in E. coli or X. campestris abrogates growth on C4-dicarboxylates .

Agricultural and Biotechnological Relevance

  • Pathogen Defense: DctA inhibitors could disrupt bacterial entry into plant hosts .

  • Bioremediation: Engineered dctA variants may enhance microbial degradation of organic acids in contaminated environments.

Comparison of Recombinant dctA Variants

ParameterQ8P5J5 (Strain C4)Q4UYH8 (Strain XC_0820)
Gene SynonymsdctA; XCC3346dctA; XC_0820
Protein SourceE. coliE. coli
Tag PositionN-terminal HisN-terminal His
Purity>90% (SDS-PAGE)>90% (SDS-PAGE)
Reconstitution BufferTris/PBS + 6% trehaloseTris/PBS + 6% trehalose

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we have in stock. However, if you have specific requirements for the format, please indicate them in your order remarks. We will fulfill your request whenever possible.
Lead Time
Delivery time may vary depending on the purchase method or location. Please consult your local distributors for specific delivery information.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is defined during production. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
dctA; xcc-b100_0852; C4-dicarboxylate transport protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-448
Protein Length
full length protein
Species
Xanthomonas campestris pv. campestris (strain B100)
Target Names
dctA
Target Protein Sequence
MHISKPAGPLPAPVPFYRQLYFQVVVAIVLGALLGHFEPAFAESLKPLGDAFIKLVKMII APVIFLTIVTGIAGMTHLKTVGRVFAKSMTYFLFFSTLALIVGMVVAHVVQPGAGMNINP AELDQSAVNTYVQKSHELSLVGFLMDIIPATLISAFVDGNILQVLFVAVLFGIALALVGE RGRPVLSFLEALTAPVFRLVHMLMKAAPIGAFGAIAFTIGKYGVESLVNLAWLVGSFYLT SLFFVLVILGIVCRLCGFSVLKLIRYLKAELLLVLGTSSSESALPSLMEKMEKAGCEKSV VGLVVPTGYSFNLDGTNIYMTLAALFIAQATNVDLTLGQQITLLAVAMLSSKGAAGVTGA GFITLAATLSVVPDVPVAGMALILGVDRFMSECRSLTNFIGNAVATVVVSRWENALDRDQ LSLALDGRAPPLQAPVPPPDAVAPVSAR
Uniprot No.

Target Background

Function
This protein is responsible for the transport of dicarboxylates such as succinate, fumarate, and malate across the membrane from the periplasm.
Database Links
Protein Families
Dicarboxylate/amino acid:cation symporter (DAACS) (TC 2.A.23) family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the C4-dicarboxylate transport protein (dctA) in Xanthomonas campestris pv. campestris?

The C4-dicarboxylate transport protein (dctA) in Xanthomonas campestris pv. campestris is a membrane-bound transport protein responsible for the uptake of C4-dicarboxylates such as succinate, fumarate, and malate across the bacterial cell membrane. These compounds serve as important carbon sources for bacterial growth and metabolism during both saprophytic growth and plant infection processes. Similar to other transport systems identified in Xcc, the dctA protein likely belongs to a family of transporters that are essential for bacterial survival and pathogenicity. The protein structure typically includes multiple transmembrane domains that facilitate substrate recognition and transport through the bacterial membrane, contributing to the metabolic versatility of this pathogen during different life stages.

What are the most effective methods for cloning and expressing recombinant Xcc dctA protein?

For efficient cloning and expression of recombinant Xcc dctA protein, researchers should first amplify the dctA gene using PCR with high-fidelity polymerase and primers designed with appropriate restriction sites based on the Xcc genome sequence. Similar to approaches used for other Xcc genes, constructing a genomic DNA library and screening by functional complementation in a suitable host system can be effective, as demonstrated with the sod gene . For expression, several systems can be employed depending on research goals: E. coli-based systems (BL21 or derivatives) are suitable for basic structural studies, while homologous expression in Xanthomonas provides more native-like protein. For membrane proteins like dctA, specialized expression strains (C41/C43) that accommodate membrane protein overexpression are recommended. Fusion tags (His6, MBP, or GST) facilitate purification, with the His6 tag being less disruptive to membrane protein function. Expression conditions require careful optimization of temperature (typically 16-25°C), inducer concentration, and duration to prevent inclusion body formation common with membrane transporters.

What challenges are associated with purifying functional dctA protein, and how can they be overcome?

Purifying functional dctA protein presents several significant challenges due to its membrane-embedded nature. The primary difficulty lies in extracting the protein while maintaining its native conformation, as inappropriate detergent selection can irreversibly denature the protein. Researchers should systematically screen a panel of detergents including mild non-ionic (DDM, LMNG) and zwitterionic (LDAO, FC-12) options at concentrations just above their critical micelle concentration. Another major challenge is low expression yield common with membrane transporters; this can be addressed by using specialized expression hosts and optimizing growth media with appropriate carbon sources. Protein aggregation during concentration steps can be mitigated by including glycerol (10-20%) and maintaining low temperatures throughout purification. For activity assessment, researchers should develop transport assays using proteoliposomes reconstituted with purified dctA and radiolabeled substrates to confirm functionality. Thermal stability assays employing differential scanning fluorimetry with appropriate modifications for membrane proteins can help identify buffer conditions that preserve protein integrity during downstream applications.

What are the recommended approaches for studying dctA substrate specificity and transport kinetics?

For comprehensive analysis of dctA substrate specificity and transport kinetics, researchers should employ a multi-faceted approach combining in vivo and in vitro methods. Whole-cell transport assays using radiolabeled C4-dicarboxylates (14C-succinate, 14C-fumarate, 14C-malate) with dctA-expressing cells versus control cells can establish the substrate range. For precise kinetic parameters, reconstituted proteoliposome systems containing purified dctA provide controlled environments for determining Km and Vmax values for each substrate through time-course uptake measurements at varying substrate concentrations. Competition assays with structurally related non-labeled compounds can reveal binding affinities and inhibition patterns. Site-directed mutagenesis of predicted substrate-binding residues, identified through homology modeling based on crystallized bacterial transporters, allows correlation of structural features with transport function. To understand physiological relevance, growth assays with Xcc wild-type versus dctA mutants on minimal media with different C4-dicarboxylates as sole carbon sources can be conducted using approaches similar to those employed for other Xcc genes . Complementation of these mutants with wildtype or modified dctA variants can validate in vitro findings in the cellular context.

How does dctA contribute to Xcc virulence and pathogenicity in host plants?

The dctA protein likely plays a significant role in Xcc virulence by facilitating the acquisition of C4-dicarboxylates that serve as carbon sources during plant colonization, particularly within the nutrient-rich vascular system where black rot symptoms develop. Similar to other essential genes in Xcc, dctA may be critical for bacterial viability during infection, as observed with the superoxide dismutase (sod) gene where mutants could not be successfully established . The transport function of dctA enables Xcc to utilize plant-derived organic acids present in the apoplast and xylem, supporting bacterial multiplication and systemic spread throughout the vascular tissues. This nutrient acquisition capability may be particularly important during the transition from initial hydathode infection to vascular colonization, where the bacteria encounter different nutrient environments. The importance of dctA might vary across infection stages and could be influenced by plant defense responses, similar to how the diffusible signal factor (DSF) from Xcc induces plant immune responses that restrict bacterial growth . Understanding dctA's contribution requires examining its expression patterns during infection using approaches similar to the sod-gus transcriptional fusion that revealed infection-specific gene induction .

How is dctA expression regulated during different stages of Xcc infection in cruciferous plants?

The expression of dctA in Xanthomonas campestris pv. campestris likely follows complex regulatory patterns during different infection stages, responding to both environmental cues and host-derived signals. Similar to the superoxide dismutase gene in Xcc, which showed variable expression according to growth stage in culture and was induced within 3-4 hours of plant inoculation , dctA expression might be upregulated during specific infection phases when C4-dicarboxylates become available. The initial colonization of hydathodes, which serve as the primary entry points for Xcc , may involve different dctA expression patterns compared to later vascular colonization stages. The regulation might involve carbon catabolite repression systems when more preferred carbon sources are available, as well as responses to plant defense molecules. Research approaches to study this regulation should include transcriptional fusions (dctA-reporter constructs) similar to the sod-gus fusion used to monitor sod expression , coupled with confocal microscopy to visualize expression in different plant tissues. RNA extraction from infected tissues at various time points followed by qRT-PCR would provide quantitative expression data, while chromatin immunoprecipitation could identify transcription factors binding to the dctA promoter during infection.

What structural features of the dctA protein contribute to substrate recognition and transport mechanism?

The dctA protein in Xanthomonas campestris pv. campestris likely possesses specific structural features that determine its substrate specificity and transport mechanism. Based on structural studies of related transporters, dctA typically contains 10-12 transmembrane helices arranged to form a central substrate translocation pathway with conserved charged residues that facilitate substrate binding and proton coupling. Critical substrate-binding residues are often located in transmembrane domains 5, 8, and 10, with positively charged amino acids interacting with the negatively charged carboxyl groups of dicarboxylate substrates. The protein likely undergoes conformational changes following an alternating access mechanism, where substrate binding sites are alternately exposed to either side of the membrane during the transport cycle. Conserved proline residues in certain transmembrane domains may serve as molecular hinges facilitating these conformational changes. Advanced structural determination techniques such as cryo-electron microscopy or X-ray crystallography, following approaches similar to those used for other bacterial membrane proteins, would be necessary to fully elucidate these features. Computational approaches including molecular dynamics simulations could complement experimental data by revealing the dynamic aspects of substrate translocation through the predicted transport channel.

What post-translational modifications influence dctA function, and how can they be detected?

Post-translational modifications (PTMs) of dctA in Xanthomonas campestris pv. campestris likely play crucial roles in regulating transport activity, membrane localization, and protein stability under varying environmental conditions. Potential PTMs affecting dctA function may include phosphorylation of cytoplasmic domains by bacterial kinases in response to metabolic states, which could modulate transport activity by altering protein conformation or substrate binding affinity. Identifying these modifications requires sophisticated analytical approaches, beginning with immunoprecipitation of epitope-tagged dctA from Xcc grown under various conditions, followed by liquid chromatography-tandem mass spectrometry (LC-MS/MS) analysis. Phosphoproteomic approaches using phospho-specific enrichment methods prior to MS analysis can detect low-abundance phosphorylation events. Site-directed mutagenesis of predicted modification sites (changing serine/threonine to alanine or to phosphomimetic aspartate) followed by functional transport assays can validate the importance of specific PTMs. Additional modifications might include oxidation of specific residues under stress conditions, similar to how Xcc responds to oxidative stress through superoxide dismutase , or S-nitrosylation in response to plant-derived reactive nitrogen species. Blue-native PAGE coupled with western blotting can reveal if dctA forms homo-oligomers or heterocomplexes with other proteins, which might be regulated by PTMs during different growth phases or infection stages.

How does plant immunity target bacterial nutrient acquisition systems including dctA?

Plant immunity appears to target bacterial nutrient acquisition systems, including transporters like dctA, as part of a multi-layered defense strategy against pathogens like Xanthomonas campestris pv. campestris. Research suggests that pattern-triggered immunity activated during bacterial infection may specifically restrict nutrient availability in the apoplastic space, effectively starving the pathogen. Plants infected with Xcc can recognize pathogen-associated molecular patterns (PAMPs) and mount defensive responses that include callose deposition and cell death-associated nuclear fragmentation , which may limit bacterial access to nutrients including C4-dicarboxylates. The diffusible signal factor (DSF) from Xcc has been shown to elicit plant defense responses that restrict bacterial growth , indicating that plants can detect bacterial communication molecules and respond by activating immunity. This plant defense response could potentially target nutrient acquisition pathways including dctA-mediated transport. Research approaches to investigate this relationship should include transcriptomic analysis of bacterial gene expression during infection of resistant versus susceptible plants, focusing on nutrient transporters including dctA. Metabolomic profiling of apoplastic fluid during infection could reveal whether C4-dicarboxylate availability changes in response to immunity activation, affecting dctA function.

Can dctA be targeted for development of novel disease control strategies against black rot?

The C4-dicarboxylate transport protein (dctA) represents a promising target for developing novel disease control strategies against black rot caused by Xanthomonas campestris pv. campestris. Given that nutrient acquisition is essential for bacterial pathogenicity, inhibiting dctA function could potentially restrict bacterial proliferation in planta. Small molecule inhibitors designed to specifically block the dctA transport channel could be developed through structure-based drug design approaches, once the protein structure is determined. These inhibitors would need to be tested for efficacy in reducing C4-dicarboxylate uptake in vitro using purified reconstituted dctA, followed by evaluation of their ability to restrict bacterial growth in planta. Another approach could involve identifying plant compounds that naturally modulate dctA function as part of induced defense responses. The effectiveness of targeting dctA should be evaluated in comparison to other approaches, such as activating plant immunity with diffusible signal factor (DSF), which has been shown to restrict Xcc growth and reduce disease symptoms . Plant breeding or engineering efforts could potentially focus on enhancing natural mechanisms that restrict nutrient availability to pathogens. A comprehensive testing protocol would include greenhouse trials with various crop species and field trials to evaluate efficacy under natural conditions across different Xcc races.

How do environmental factors and host metabolic status influence dctA function during infection?

Environmental factors and host metabolic status significantly influence dctA function during Xanthomonas campestris pv. campestris infection through complex interactions that affect both nutrient availability and bacterial gene expression. Temperature fluctuations likely impact dctA activity, with optimal transport occurring at temperatures that favor Xcc growth (25-30°C), while extreme temperatures may alter protein conformation and impair substrate transport. Humidity levels, which influence disease development and severity in black rot , may affect leaf water potential and consequently the concentration of C4-dicarboxylates in apoplastic fluids, directly impacting substrate availability for dctA. The host plant's developmental stage and nutritional status create varying C4-dicarboxylate profiles throughout the plant, with mature leaves potentially providing different substrate landscapes compared to young, developing tissues. Diurnal cycles in plant metabolism likely result in fluctuating concentrations of organic acids, requiring dctA expression to be temporally regulated to maximize nutrient acquisition. During infection, the relationship between carbon source availability and disease progression becomes complex, as Xcc invasion through hydathodes exposes bacteria to different nutrient environments compared to later vascular colonization stages. Research methodology to investigate these relationships should include metabolomic analysis of apoplastic fluid under various environmental conditions, combined with real-time monitoring of dctA expression using luminescent or fluorescent reporter constructs.

What methodologies are most effective for studying dctA in the context of Xcc infection in real-time?

For real-time investigation of dctA function during Xanthomonas campestris pv. campestris infection, researchers should employ a combination of advanced imaging, genetic, and analytical approaches. Fluorescent protein fusions (dctA-GFP/mCherry) expressed under native promoters provide visual tracking of protein localization during infection, particularly when coupled with confocal microscopy of infected plant tissues. These constructs should be validated to ensure transport functionality remains intact. For temporal expression patterns, transcriptional fusions with luciferase reporters enable real-time monitoring of gene expression through bioluminescence, similar to approaches using bioluminescent reporter strains of Xcc . FRET-based biosensors can be developed to detect C4-dicarboxylate concentrations in bacterial microenvironments during infection. To assess functional transport in planta, isotope labeling experiments using 13C-labeled dicarboxylates applied to infected plants, followed by mass spectrometry analysis of extracted bacteria, can trace substrate uptake patterns. Genome-wide transcriptional profiling at multiple infection timepoints using RNA-seq can place dctA expression in context with other virulence factors. Innovative approaches like microfluidic devices containing living plant cells can simulate infection conditions while allowing precise control of the microenvironment for real-time imaging of bacterial responses, similar to the methodology used to monitor bacterial growth in plant tissues .

What data analysis approaches are recommended for interpreting complex datasets related to dctA function?

Analyzing complex datasets related to dctA function in Xanthomonas campestris pv. campestris requires sophisticated computational approaches that integrate multiple data types. For transcriptomic data, differential expression analysis should identify co-regulated gene clusters that function alongside dctA, using tools like DESeq2 or EdgeR with appropriate statistical thresholds (p-adjusted < 0.05, log2FC > 1). Gene Set Enrichment Analysis can then determine whether dctA expression correlates with specific metabolic pathways or virulence functions. For proteomics datasets examining dctA interactions or post-translational modifications, specialized software like MaxQuant followed by Perseus analysis enables identification of significant protein-protein interactions and modification sites. Integration of transcriptomic and proteomic data through correlation networks can reveal discrepancies between transcript and protein levels that might indicate post-transcriptional regulation. Metabolomic data analyzing C4-dicarboxylate utilization should employ multivariate statistical approaches like Principal Component Analysis and Partial Least Squares Discrimination Analysis to identify metabolite signatures associated with dctA function across different conditions. Machine learning approaches can be valuable for predicting regulatory elements controlling dctA expression from sequence data. For real-time imaging data, computational image analysis using dedicated software can quantify bacterial colonization patterns and protein localization dynamics, which can be correlated with disease progression metrics using time-series analysis methods.

What are the most promising future research directions for understanding dctA's role in Xcc pathogenicity?

The most promising future research directions for understanding dctA's role in Xanthomonas campestris pv. campestris pathogenicity include several innovative approaches that could fundamentally advance our understanding of bacterial nutrient acquisition during infection. Cryo-electron microscopy determination of dctA structure in different conformational states would provide unprecedented insights into the transport mechanism and substrate recognition, enabling rational design of specific inhibitors. CRISPR-Cas9 based genome editing could generate precisely controlled dctA variants to assess the contribution of specific domains to virulence without polar effects common in traditional mutagenesis. Systems biology approaches integrating transcriptomics, proteomics, and metabolomics data from both pathogen and host during infection would reveal how dctA function coordinates with broader virulence networks and host responses. Single-cell RNA-seq of bacteria extracted from different plant tissues could uncover population heterogeneity in dctA expression that might contribute to persistent infections. Advanced biosensors based on RNA aptamers or protein conformational changes could be developed to monitor C4-dicarboxylate concentrations in bacterial microenvironments during infection in real-time. Comparative studies across Xanthomonas strains with different host ranges could reveal how dctA variation contributes to host specificity. Development of high-throughput screening platforms to identify natural or synthetic compounds that specifically inhibit dctA without affecting plant transporters could lead to novel disease control strategies, building on the observation that host-directed disease control approaches can effectively limit Xcc infection .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.