Recombinant Xanthomonas campestris pv. campestris DNA translocase FtsK (ftsK)

Shipped with Ice Packs
In Stock

Description

Definition and Production of Recombinant Xanthomonas campestris pv. campestris DNA Translocase FtsK (ftsK)

Recombinant Xanthomonas campestris pv. campestris DNA translocase FtsK (ftsK) is a laboratory-engineered protein expressed in Escherichia coli, retaining the functional domains and catalytic properties of its native counterpart. This ATP-dependent motor protein facilitates chromosomal DNA translocation and coordinates chromosome segregation during bacterial cell division. It is characterized by a hexameric ring structure with a central channel for double-stranded DNA (dsDNA) and a regulatory γ domain that binds polarized DNA motifs (KOPS) to ensure directional translocation toward the dif site .

Mechanism of Action

FtsK operates via a rotary inchworm mechanism, where conformational changes in the hexameric ring drive DNA translocation. Single-molecule assays confirm its ability to reverse direction and remove obstacles (e.g., proteins) from DNA .

Role in Chromosome Segregation and XerCD Recombination

FtsK interacts with the XerCD tyrosine recombinases to resolve chromosome dimers at the dif site. This process is essential for:

  • Chromosome Dimer Resolution (CDR): Ensures proper segregation of sister chromatids during cell division .

  • Topological Control: Restricts recombination to the terminus region by aligning dif sites via KOPS-directed translocation .

Regulation of XerCD Activity

ProcessFtsK's Role
Strand Exchange InitiationDirect interaction between FtsK<sub>γ</sub> and XerD's C-terminal domain triggers recombination .
Topological SimplificationTranslocation forces dif sites into a synapse, preventing catenane formation .
Recombination EfficiencyATPase activity enhances XerCD catalysis, increasing crossover resolution rates .

Comparative Analysis in Bacterial Species

FtsK's functional importance varies across species:

SpeciesEssentialityPrimary RoleKey References
E. coliNon-essentialDimer resolution (~15% cell divisions)
V. choleraeNon-essentialDimer resolution (~10% cell divisions)
Caulobacter crescentusEssentialChromosome decatenation
X. campestrisContext-dependentHorizontal gene transfer, pathogenicity

Research Applications and Implications

  1. Mechanistic Studies:

    • Single-molecule assays to dissect ATP hydrolysis and DNA translocation dynamics .

    • Structural analysis of FtsK<sub>γ</sub>-XerD interactions using cryo-EM and crystallography .

  2. Pathogenicity Insights:

    • Recombinant FtsK’s role in facilitating horizontal gene transfer and genomic plasticity in Xanthomonas species .

  3. Biotechnological Potential:

    • Engineering FtsK variants to manipulate DNA topology in synthetic biology systems.

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order. We will accommodate your request if possible.
Lead Time
Delivery time may vary depending on the purchase method and location. Please contact your local distributor for specific delivery timeframes.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life of the protein is influenced by various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have specific tag type preferences, please inform us and we will prioritize development of the specified tag.
Synonyms
ftsK; XCC1972; DNA translocase FtsK
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-785
Protein Length
full length protein
Species
Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
Target Names
ftsK
Target Protein Sequence
MAKQVPERSKPAEGKSSSRKPAAADTPRRQKLWRDLALIAVAPLLLYLLASLFTYSAADP GWSQTGSVVAPVHNMGGRVGAWIADVLLQLFGYVAFLLPVVLGAVAWIALFGMDKEGQAE ADLGPALRLVGMVGFLIASTGFLHLRLFNGDVAGAGGILGRLVSNSLSAGFGALGANLFV VVLLLVSITLATGLSWFVVMERIGKWVLALGPLLQRKSHQATEWQQTRVMREEREEVRKV DAVKQAKREPVKIEPPPAPVVEKSERAKRDTQIPMFQGVSTDGSDLPPLALLDDPKPQAK GYSEETLETLSRQIEFKLKDFRIEAQVVGAYPGPVITRFEIEPAPGVKVSQISSLDKDIA RGLSVKSVRVVDVIPGKSVVGLEIPNVTREMIFLSELLRSKEYDKSASPLTLALGKDIAG RPTVADLARMPHLLVAGTTGSGKSVAVNAMVLSLLFKASHKELRMLMIDPKMLELSVYQG IPHLLAPVVTDMKEAANGLRWCVAEMERRYKLMSAVGVRNLAGFNKKVKDAEDAGQPMMD PLFKPNPELGEAPRPLETLPFIVIFIDEFADMMMIVGKKVEELIARLAQKARAAGIHLIL ATQRPSVDVITGLIKANIPTRVAFQVSSKIDSRTILDQSGAEALLGNGDMLYLPPGTALP DRVHGAFVSDEEVHRVVEHLKASGPVAYVDGVLDEVQTMGDGTVVGATGLPESSGGGGDE SDPLYDEALRIVTETRRASISGVQRRLKIGYNRAARLIEAMEAAGVVSPPEHNGDRTVLA PPPPK
Uniprot No.

Target Background

Function
Essential cell division protein that coordinates cell division and chromosome segregation. The N-terminus is involved in assembling the cell-division machinery. The C-terminus functions as a DNA motor that moves dsDNA in an ATP-dependent manner towards the dif recombination site, which is located within the replication terminus region. Translocation stops specifically at Xer-dif sites, where FtsK interacts with the Xer recombinase, allowing activation of chromosome unlinking by recombination. FtsK orienting polar sequences (KOPS) guide the direction of DNA translocation. FtsK can remove proteins from DNA as it translocates, but translocation stops specifically at XerCD-dif site, thereby preventing removal of XerC and XerD from dif.
Database Links

KEGG: xcc:XCC1972

STRING: 190485.XCC1972

Protein Families
FtsK/SpoIIIE/SftA family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is FtsK DNA translocase and what is its primary function in bacterial cells?

FtsK is a double-stranded DNA translocase that functions as a molecular motor, converting the chemical energy of ATP binding and hydrolysis into mechanical movement of DNA substrates. In bacteria, including Xanthomonas campestris pv. campestris, FtsK is localized to the septum (the site of cell division) where it serves as a DNA pump during the late stages of the cell cycle. Its primary functions include expediting cytokinesis and facilitating chromosome segregation, which are critical processes for bacterial cell division . The protein operates by moving DNA at an extraordinarily rapid rate of over 5,000 base pairs per second and possesses sufficient power to displace other proteins bound to the DNA .

What are the structural domains of the FtsK protein and what roles do they play?

The FtsK protein consists of two main structural regions with distinct functions:

  • N-terminal domain: Involved in cell-cycle-specific localization and assembly of the cell-division machinery at the septum.

  • C-terminal domain: Forms the motor portion of the protein and can be further subdivided into three subdomains:

    • α subdomain: Contributes to multimerization and forms part of the hexameric ring structure

    • β subdomain: Also participates in multimerization and contains the RecA-like nucleotide-binding/hydrolysis fold

    • γ subdomain: Serves as a regulatory domain that binds to polarized chromosomal sequences known as KOPS (5'-GGGNAGGG-3'), providing directionality to the motor's activity

Together, the α and β domains multimerize to produce a hexameric ring with a central channel that accommodates double-stranded DNA, forming the core of the motor complex .

How does the directional control mechanism of FtsK function on a molecular level?

The directional control of FtsK translocation is governed by a sophisticated molecular mechanism centered on the γ subdomain of the C-terminal motor region. This regulatory domain specifically recognizes and binds to polarized chromosomal sequences known as KOPS (FtsK-Orienting Polar Sequences), which have the consensus sequence 5'-GGGNAGGG-3' . These KOPS elements are not randomly distributed throughout the bacterial chromosome but are strategically positioned with a specific orientation bias that points toward the terminus region where replication typically concludes.

When the FtsK hexamer encounters a KOPS sequence, the γ subdomain binds to it in a specific orientation, ensuring that the motor loads onto the DNA in the correct configuration. This orientation-specific loading guarantees that subsequent translocation proceeds unidirectionally toward the terminus region of the chromosome, specifically targeting the 28 bp dif site located in this region . This directional control is essential for proper chromosome segregation during cell division.

The molecular interaction between the γ subdomain and KOPS involves specific amino acid residues that recognize the nucleotide sequence pattern. Mutations in these residues can disrupt the recognition process and lead to bidirectional or random translocation, highlighting the critical nature of this interaction for FtsK function.

What are the optimal biochemical conditions for studying the ATPase activity of recombinant FtsK from Xanthomonas campestris?

For optimal investigation of the ATPase activity of recombinant X. campestris FtsK, researchers should consider the following biochemical conditions:

ParameterOptimal ConditionNotes
pH7.5-8.0Using Tris-HCl buffer
Temperature30-37°CX. campestris proteins typically show optimal activity in this range
Salt concentration50-100 mM NaCl or KClHigher concentrations may inhibit activity
Divalent cations5-10 mM MgCl₂Essential cofactor for ATP hydrolysis
ATP concentration1-5 mMSubstrate concentration range for kinetic studies
DNA substrateLinear dsDNA (>2 kb)Preferably containing KOPS sequences
Protein concentration50-200 nM (hexamer)Higher concentrations may lead to aggregation

The ATPase activity should be measured using standard techniques such as coupled enzyme assays (e.g., pyruvate kinase/lactate dehydrogenase system) or direct detection of inorganic phosphate release. When designing experiments, it's important to include appropriate controls, such as testing ATPase activity in the absence of DNA to establish baseline activity, and using ATPase-deficient mutants (e.g., Walker A motif mutations) as negative controls.

The reaction buffer should be supplemented with reducing agents (e.g., 1-5 mM DTT or 2-10 mM β-mercaptoethanol) to maintain protein stability and prevent oxidation of critical cysteine residues that might affect activity.

What are the most effective expression systems for producing active recombinant X. campestris FtsK protein?

Expression SystemAdvantagesLimitationsRecommended Conditions
E. coli BL21(DE3)High yield, simple culture conditions, economicalMay not reproduce all post-translational modificationsInduction with 0.5-1.0 mM IPTG at OD₆₀₀ = 0.6-0.8; culture at 18-25°C post-induction for 12-16 hours
E. coli Rosetta™Better expression of proteins with rare codonsSlightly lower yield than BL21Similar to BL21, but with addition of chloramphenicol to maintain the pRARE plasmid
E. coli Arctic Express™Enhanced folding at lower temperaturesSlower growth, more expensiveInduction at 12-16°C for 24-48 hours
Insect cell/BaculovirusBetter folding and post-translational modificationsComplex, time-consuming, expensiveInfection at MOI of 1-5, harvest 48-72 hours post-infection

For the full-length X. campestris FtsK protein (785 amino acids), expression strategies should address several challenges:

  • Protein solubility: The N-terminal domain contains transmembrane regions that can cause aggregation. Consider expressing the C-terminal motor domain separately for studies focusing on translocation activity.

  • Affinity tags: An N-terminal His-tag has proven effective for purification without compromising activity . If the His-tag affects function, inclusion of a TEV protease cleavage site allows tag removal.

  • Expression temperature: Lower temperatures (16-25°C) after induction generally improve the solubility and proper folding of large multidomain proteins like FtsK.

  • Co-expression with chaperones: For challenging constructs, co-expression with molecular chaperones (GroEL/GroES, DnaK/DnaJ/GrpE) can improve folding and solubility.

  • Buffer composition: The storage buffer should contain 6% trehalose at pH 8.0 to stabilize the protein structure during storage . Working stocks should be maintained at 4°C for up to one week, with long-term storage at -20°C/-80°C.

What are the recommended methods for assessing the DNA binding and translocation activities of recombinant FtsK?

Several complementary methods can be employed to comprehensively assess the DNA binding and translocation activities of recombinant FtsK:

DNA Binding Assays:

  • Electrophoretic Mobility Shift Assay (EMSA):

    • Incubate varying concentrations of purified FtsK (10-500 nM) with fluorescently labeled DNA fragments (50-100 nM, 40-100 bp) containing KOPS sequences

    • Analyze complex formation by native PAGE

    • Include competition assays with unlabeled DNA to assess specificity

  • Fluorescence Anisotropy:

    • Use fluorescently labeled DNA fragments (20-40 bp)

    • Titrate with increasing concentrations of FtsK

    • Measure changes in anisotropy to determine binding constants

    • Compare binding affinities for KOPS-containing versus random sequences

  • Surface Plasmon Resonance (SPR):

    • Immobilize biotinylated DNA on streptavidin-coated sensor chips

    • Flow FtsK protein over the surface

    • Measure association and dissociation kinetics

    • Determine kon, koff, and KD values

Translocation Assays:

  • Triplex Displacement Assay:

    • Design DNA substrates containing a triplex-forming oligonucleotide bound to specific sites

    • Monitor displacement of the triplex by FtsK translocation in real-time using fluorescence

    • Calculate translocation rates from displacement kinetics

  • Single-Molecule Techniques:

    • Magnetic Tweezers: Tether DNA between a surface and a magnetic bead, apply force, and monitor FtsK-induced DNA length changes

    • Optical Tweezers: Similar setup but using optical forces, offering higher resolution

    • TIRF Microscopy: Visualize fluorescently labeled FtsK moving along surface-tethered DNA

  • ATP Hydrolysis Coupled Assays:

    • Measure ATP consumption during translocation using coupled enzyme systems

    • Calculate the ATP hydrolysis rate per base pair translocated

    • Compare rates on different DNA substrates

Assay TypeInformation ObtainedTechnical ComplexitySample Requirements
EMSAQualitative binding, approximate KdLow10-20 μg protein
Fluorescence AnisotropyPrecise Kd, binding kineticsMedium5-10 μg protein
SPRDetailed binding kineticsHigh20-50 μg protein
Triplex DisplacementTranslocation rate, processivityMedium10-20 μg protein
Single-MoleculeStep size, force generation, heterogeneityVery High1-5 μg protein
ATP HydrolysisCoupling ratio, mechanochemical efficiencyMedium5-10 μg protein

When designing these experiments, it's crucial to include appropriate controls, such as ATPase-deficient mutants and DNA substrates lacking KOPS sequences, to establish the specificity and ATP-dependence of the observed activities.

How can one study the hexamerization dynamics of FtsK and its impact on translocation activity?

Studying the hexamerization dynamics of FtsK and correlating it with translocation activity requires a multifaceted approach combining biophysical, biochemical, and functional assays:

Biophysical Methods for Hexamer Characterization:

  • Size Exclusion Chromatography with Multi-Angle Light Scattering (SEC-MALS):

    • Determine absolute molecular weight of FtsK complexes under different conditions

    • Monitor hexamer formation as a function of protein concentration

    • Assess the impact of nucleotides (ATP, ADP, AMP-PNP) on oligomeric state

  • Analytical Ultracentrifugation (AUC):

    • Characterize sedimentation properties of FtsK monomers and hexamers

    • Determine equilibrium constants for hexamerization

    • Evaluate the effects of DNA and nucleotides on complex formation

  • Negative Stain Electron Microscopy:

    • Visualize hexamer ring structures

    • Assess conformational states with and without DNA/nucleotides

    • Quantify the proportion of complete hexamers versus partial complexes

  • FRET-Based Assays:

    • Label FtsK monomers with donor and acceptor fluorophores

    • Monitor FRET signal changes during hexamerization

    • Assess kinetics of assembly and disassembly in real-time

Correlating Hexamerization with Activity:

  • Chemical Crosslinking Coupled to Activity Assays:

    • Stabilize hexamers using crosslinking agents (e.g., BS3, glutaraldehyde)

    • Verify hexamer formation by SDS-PAGE or mass spectrometry

    • Compare translocation activity of crosslinked versus non-crosslinked samples

  • Site-Directed Mutagenesis of Interface Residues:

    • Identify and mutate key residues at subunit interfaces

    • Assess impact on hexamer stability using biophysical methods

    • Correlate hexamerization defects with translocation activity

  • Subunit Mixing Experiments:

    • Combine wild-type and inactive FtsK variants at different ratios

    • Determine the minimum number of active subunits required for translocation

    • Assess whether all subunits in the hexamer need to be catalytically active

Experimental Design Matrix:

VariableCondition RangeMeasurement MethodsExpected Outcomes
Protein concentration10 nM - 10 μMSEC-MALS, AUCDetermination of Kd for hexamerization
Nucleotide stateATP, ADP, AMP-PNP, NoneSEC-MALS, EMImpact of nucleotide binding on assembly
DNA presenceAbsent, Non-specific, KOPS-containingFRET, CrosslinkingRole of DNA in promoting assembly
Salt concentration50-500 mM NaClAUC, Activity assaysIonic strength effects on stability/activity
MutationsInterface residues, catalytic residuesAll methodsStructure-function relationships

The combined results from these approaches would provide a comprehensive understanding of FtsK hexamerization dynamics and how they relate to translocation activity. This information is crucial for developing accurate mechanistic models of how FtsK functions as a molecular motor during bacterial cell division.

What are the common challenges in interpreting kinetic data from FtsK translocation assays and how can they be addressed?

Interpreting kinetic data from FtsK translocation assays presents several challenges that researchers should be aware of:

Analysis Workflow for FtsK Translocation Data:

  • Verify protein quality and hexamerization state

  • Perform preliminary experiments to establish linearity ranges

  • Collect raw data across multiple conditions (ATP concentration, salt, temperature)

  • Apply appropriate corrections for background and instrumental drift

  • Normalize data to facilitate comparison between experiments

  • Fit to mechanistic models and extract kinetic parameters

  • Validate model by testing predictions with additional experiments

By addressing these challenges methodically, researchers can obtain more reliable and interpretable kinetic data from FtsK translocation assays, leading to deeper insights into the mechanistic details of this remarkable molecular motor.

How should researchers compare and contrast the functional properties of FtsK from Xanthomonas campestris with those from other bacterial species?

When comparing the functional properties of FtsK from Xanthomonas campestris with orthologs from other bacterial species, researchers should adopt a systematic approach that addresses multiple aspects of protein function and structure:

Recommended Comparative Framework:

  • Sequence and Structural Analysis:

    • Perform multiple sequence alignments of full-length proteins and individual domains

    • Calculate sequence conservation across species, particularly in functional motifs

    • Construct phylogenetic trees to understand evolutionary relationships

    • Generate homology models if X-ray structures are unavailable

    • Compare predicted secondary and tertiary structures

  • Expression and Biochemical Characterization:

    • Express recombinant proteins using identical systems and conditions

    • Purify using standardized protocols to minimize preparation differences

    • Determine basic biochemical parameters under identical conditions:

      • ATPase activity (Km, Vmax, kcat)

      • DNA binding affinity for various substrates

      • Oligomerization properties

      • Stability under various conditions

  • Functional Assays:

    • Compare translocation rates and processivity

    • Assess directional preference and KOPS recognition specificity

    • Evaluate ability to resolve DNA topological structures

    • Determine force generation capacity

    • Test interaction with other divisome components

  • Specialized Comparative Analyses:

ParameterExperimental ApproachKey Comparisons
KOPS recognitionEMSA, SPR with species-specific KOPSBinding affinity, specificity, sequence preferences
Translocation kineticsTriplex displacement, single-moleculeVelocity, processivity, force-velocity relationship
ATP couplingATPase assays with DNAATP consumption per bp translocated
Partner protein interactionsPull-downs, Y2H, BLIXerCD interaction, divisome integration
In vivo functionalityCross-species complementationAbility to complement FtsK mutants in other species
  • Data Interpretation Guidelines:

    When interpreting comparative data, researchers should consider several contextual factors:

    • Evolutionary distance: Differences should be interpreted in the context of evolutionary relationships

    • Ecological niche: Consider how the bacterial lifestyle might influence FtsK function

    • Genome organization: Differences in chromosome structure and organization may explain functional adaptations

    • Cell division mechanisms: Variations in the cell division process may correlate with FtsK functional differences

  • Standardized Reporting Format:

    To facilitate meaningful comparisons across studies, data should be reported in a standardized format:

    • Include raw data as supplementary material

    • Report both absolute values and relative comparisons (e.g., X. campestris FtsK is 1.5× faster than E. coli FtsK)

    • Specify all experimental conditions in detail

    • Use consistent units and normalization methods

By following this comprehensive comparative framework, researchers can systematically identify conserved features that represent core FtsK functions as well as species-specific adaptations that may reflect particular evolutionary pressures or mechanistic variations in chromosome segregation and cell division across different bacterial species.

What are the most promising approaches for studying the role of FtsK in chromosome segregation in Xanthomonas campestris?

Several innovative approaches hold significant promise for elucidating the role of FtsK in chromosome segregation in Xanthomonas campestris:

  • Advanced Live-Cell Imaging Techniques:

    Implementing fluorescence microscopy with photoactivatable or photoconvertible fluorescent proteins fused to FtsK would allow precise spatiotemporal tracking of FtsK dynamics during the cell cycle. Super-resolution microscopy techniques such as PALM, STORM, or STED can overcome the diffraction limit to visualize FtsK localization and movement with nanometer precision. Time-lapse imaging combined with fluorescently labeled chromosomal loci would enable correlation between FtsK activity and chromosome movement.

  • Genome Engineering and Synthetic Biology Approaches:

    CRISPR-Cas9 genome editing can be employed to introduce precise mutations in the endogenous ftsK gene, allowing the study of specific domain functions without overexpression artifacts. Synthetic biology approaches, such as constructing minimal segregation systems with defined components, could help isolate and characterize FtsK's specific contributions to chromosome segregation.

  • Systems Biology Integration:

    Comprehensive protein-protein interaction mapping using techniques such as BioID or APEX proximity labeling can identify the complete FtsK interactome during different cell cycle stages. Combining this with transcriptomics, proteomics, and chromosome conformation capture techniques (Hi-C) would provide a systems-level understanding of how FtsK coordinates with other factors to ensure proper chromosome segregation.

  • In Vitro Reconstitution Assays:

    Developing in vitro systems that reconstitute chromosome segregation with purified components would allow precise manipulation and measurement of FtsK activity. Microfluidic devices combined with surface-tethered DNA curtains could visualize multiple FtsK motors acting simultaneously on DNA substrates that mimic chromosome organization.

  • Comparative Genomics and Evolutionary Studies:

    Analyzing the distribution and conservation of FtsK and its recognition sequences across Xanthomonas species and strains can provide insights into its evolutionary adaptation and specialized functions in this genus. This approach could reveal how FtsK activity may be optimized for the specific genome organization and cell division patterns of Xanthomonas compared to other bacteria.

Research Priority Matrix:

ApproachTechnical FeasibilityPotential ImpactResource RequirementsTime Frame
Advanced ImagingHighHighModerate-High1-2 years
Genome EngineeringModerateHighModerate1-3 years
Systems BiologyModerateVery HighHigh2-4 years
In Vitro ReconstitutionChallengingHighModerate-High2-3 years
Comparative GenomicsHighModerate-HighLow-Moderate1-2 years

Each of these approaches addresses different aspects of FtsK function in chromosome segregation, and their integration would provide a comprehensive understanding of this complex molecular machinery in Xanthomonas campestris. The most robust research strategy would involve parallel pursuit of several of these approaches with regular integration of findings to build a coherent model of FtsK's role in chromosome dynamics during bacterial cell division.

What are the potential applications of understanding FtsK mechanism for developing new antimicrobial strategies against Xanthomonas infections?

Understanding the mechanism of FtsK in Xanthomonas campestris presents several promising avenues for developing novel antimicrobial strategies against this important plant pathogen:

  • Targeted Inhibition of FtsK Motor Activity:

    Since FtsK is essential for chromosome segregation during cell division, compounds that specifically inhibit its ATPase activity or DNA translocation function could serve as effective antimicrobials. Small molecule inhibitors targeting the ATP-binding pocket of the motor domains could be designed based on structural studies and in silico screening. High-throughput assays measuring FtsK translocation efficiency could identify lead compounds from chemical libraries that specifically disrupt this activity.

  • Disruption of FtsK-KOPS Recognition:

    The γ-domain of FtsK specifically recognizes KOPS sequences to ensure directional translocation. Peptides or nucleic acid analogs that mimic KOPS sequences could competitively inhibit this interaction, disrupting the directional control of FtsK and causing chromosome segregation defects. Alternatively, compounds that bind directly to the γ-domain and alter its DNA-binding properties could achieve similar effects.

  • Interference with FtsK Hexamerization:

    Since FtsK functions as a hexameric ring, compounds that disrupt hexamer formation or stability would prevent proper motor assembly and function. Potential approaches include:

    • Small molecules that bind at subunit interfaces

    • Peptides derived from interface regions that act as competitive inhibitors

    • Allosteric modulators that induce conformational changes incompatible with oligomerization

  • Targeting FtsK-XerCD Interactions:

    FtsK activates XerCD recombinases to resolve chromosome dimers. Disrupting this specific protein-protein interaction could prevent proper chromosome resolution without affecting other cellular functions. Peptide inhibitors based on interface regions or small molecules identified through fragment-based screening could selectively block this interaction.

  • Delivery Systems for Agricultural Applications:

    For practical use against Xanthomonas plant infections, delivery systems could include:

    • Nanoparticle formulations for improved stability and cellular uptake

    • Conjugation to plant-penetrating peptides for systemic distribution

    • Integration into slow-release materials for prolonged field protection

    • Co-formulation with traditional copper-based bactericides for synergistic effects

Comparative Advantages of FtsK-Targeted Approaches:

Antimicrobial StrategySpecificityResistance PotentialDevelopment TimelineEnvironmental Impact
FtsK ATPase inhibitorsModerate-HighModerate3-5 yearsLow
KOPS-mimeticsVery HighLow2-4 yearsVery Low
Hexamerization disruptorsHighLow-Moderate3-5 yearsLow
XerCD interaction blockersVery HighLow3-4 yearsVery Low
Traditional copper bactericidesLowHigh (already observed)In useModerate-High
  • Translational Research Roadmap:

    The development of FtsK-targeted antimicrobials should follow these progressive stages:

    a. Basic Mechanism Elucidation: Complete characterization of X. campestris FtsK structure-function relationships

    b. Target Validation: Genetic and chemical biology approaches to confirm druggability

    c. Assay Development: High-throughput biochemical and cellular assays for compound screening

    d. Lead Discovery: Identification of compounds with activity against FtsK functions

    e. Lead Optimization: Structure-guided enhancement of potency and selectivity

    f. Agricultural Formulation: Development of appropriate delivery systems for field use

    g. Field Testing: Evaluation of efficacy against Xanthomonas infections in crop plants

    h. Resistance Monitoring: Assessment of potential resistance development

The highly conserved nature of FtsK's essential functions, combined with structural differences between bacterial and eukaryotic DNA translocases, makes it an attractive target for developing narrow-spectrum antimicrobials against Xanthomonas with potentially minimal environmental impact compared to current broad-spectrum approaches.

What are the key knowledge gaps in our understanding of Xanthomonas campestris FtsK that require further research?

Despite significant advances in our understanding of FtsK function in model organisms, several critical knowledge gaps remain regarding Xanthomonas campestris FtsK that warrant dedicated research efforts:

  • Structural Characterization:

    No high-resolution structures of X. campestris FtsK domains are currently available. Determining the crystal or cryo-EM structures of the motor domains (α, β, γ) would provide critical insights into species-specific features that might influence function and could guide targeted inhibitor design.

  • KOPS Recognition Specificity:

    While KOPS sequences (5'-GGGNAGGG-3') have been characterized in model organisms like E. coli , the specific DNA motifs recognized by X. campestris FtsK γ-domain remain unidentified. Genome-wide analysis of sequence distributions combined with biochemical binding studies is needed to identify these species-specific directional cues.

  • Integration with Plant Pathogenesis:

    The relationship between chromosome segregation dynamics and virulence in this plant pathogen remains unexplored. Research is needed to determine whether FtsK function influences expression or delivery of virulence factors, and whether stress conditions encountered during plant infection affect FtsK activity.

  • Interaction Network:

    The protein-protein interaction network of FtsK in X. campestris has not been mapped. Identifying species-specific interaction partners would reveal how FtsK is integrated into the divisome and chromosome segregation machinery in this organism.

  • Regulatory Mechanisms:

    How FtsK activity is regulated during the cell cycle in X. campestris remains unknown. Potential regulatory mechanisms including phosphorylation, proteolytic processing, or interaction with regulatory proteins need investigation.

  • In Vivo Dynamics:

    Real-time visualization of FtsK movement and localization during X. campestris cell division has not been achieved. Advanced imaging approaches are needed to correlate FtsK dynamics with chromosome movement and cell cycle progression.

  • Environmental Adaptations:

    How FtsK function adapts to the environmental conditions encountered by X. campestris during its lifecycle, particularly during plant infection, represents a significant knowledge gap. Studies examining FtsK activity under different stress conditions would provide valuable insights.

  • Coordination with DNA Repair:

    The potential role of FtsK in coordinating chromosome segregation with DNA repair processes in response to damage (particularly relevant during plant immune responses) remains unexplored.

Addressing these knowledge gaps will require multidisciplinary approaches combining structural biology, biochemistry, molecular genetics, advanced microscopy, and bioinformatics. Resolving these questions would not only advance our understanding of this important molecular machine but could also reveal new targets for controlling Xanthomonas infections in agricultural settings.

What standardized methodologies should be adopted to ensure reproducibility in FtsK research across different laboratories?

To enhance reproducibility and facilitate comparison of results across different laboratories studying FtsK, the following standardized methodologies and reporting practices should be adopted:

  • Protein Production and Characterization:

    • Expression constructs: Deposit full sequences in public databases with unique identifiers

    • Expression conditions: Standardize and fully document growth media, induction parameters, and harvest times

    • Purification protocols: Develop detailed step-by-step protocols including buffer compositions, column types, and elution conditions

    • Quality control metrics: Implement minimum criteria for purity (>95% by SDS-PAGE), homogeneity (analytical SEC), and specific activity (ATP hydrolysis rate)

    • Storage conditions: Standardize buffer composition, protein concentration, and flash-freezing protocols

  • Activity Assays:

    • Standard DNA substrates: Establish a repository of standard DNA constructs with defined sequences, including standardized KOPS-containing substrates

    • Assay conditions: Define standard buffer compositions, temperatures, and component concentrations

    • Data acquisition parameters: Standardize instrument settings, sampling frequencies, and data processing algorithms

    • Reference standards: Include well-characterized FtsK variants (e.g., from E. coli) as internal controls

    • Reporting units: Use consistent units for reporting translocation rates, ATP hydrolysis rates, and binding constants

  • Statistical Analysis and Data Reporting:

    • Replication requirements: Minimum of three independent protein preparations and experimental replicates

    • Statistical methods: Standardized approaches for outlier identification, significance testing, and curve fitting

    • Raw data access: Deposit complete datasets in public repositories

    • Methodology reporting: Adopt detailed methods sections following structured templates

    • Negative results: Encourage publication of well-conducted studies with negative results

  • Recommended Standardized Methods Table:

ParameterRecommended Standard MethodKey Variables to Report
ATPase activityNADH-coupled spectrophotometric assayBuffer composition, temperature, DNA substrate, enzyme concentration
DNA bindingFluorescence anisotropy with fluorescein-labeled DNADNA sequence, buffer conditions, equilibration time, temperature
Translocation rateTriplex displacement assayDNA substrate length, triplex sequence, buffer composition, temperature
HexamerizationSize exclusion chromatography with multi-angle light scatteringBuffer conditions, protein concentration, flow rate, column specifications
In vivo functionComplementation of temperature-sensitive FtsK mutantsStrain background, growth conditions, expression levels of complement
  • Research Resource Identifiers:

    • Assign unique identifiers to key resources including:

      • Plasmids and genetic constructs

      • Recombinant protein preparations

      • Cell lines and bacterial strains

      • Specialized equipment setups

      • Custom software and analysis algorithms

  • Interlaboratory Validation:

    • Establish a consortium for periodic round-robin testing of key FtsK properties

    • Develop standard samples that can be distributed to multiple laboratories

    • Create benchmark datasets for calibrating new equipment or methods

    • Publish consensus protocols based on interlaboratory validation results

  • Training and Knowledge Transfer:

    • Develop standardized training modules for new researchers

    • Create video protocols demonstrating key techniques

    • Establish mentoring relationships between established and new laboratories

    • Organize practical workshops focused on standardized methodologies

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.