Recombinant Xanthomonas campestris pv. campestris Glucans biosynthesis glucosyltransferase H (opgH)

Shipped with Ice Packs
In Stock

Description

Product Overview

Recombinant OpgH is a full-length protein (1–645 amino acids) expressed in Escherichia coli with an N-terminal His tag for purification. Key specifications include:

ParameterDetails
UniProt IDQ4UYZ8
SpeciesXanthomonas campestris pv. campestris
Expression SystemE. coli
TagHis tag
Molecular Weight~97 kDa (predicted)
Purity>90% (SDS-PAGE)
FormLyophilized powder in Tris/PBS buffer with 6% trehalose (pH 8.0)
Storage-20°C/-80°C; reconstitution in sterile water with glycerol recommended

The amino acid sequence includes conserved glycosyltransferase domains critical for enzymatic activity .

Enzymatic Function

Opgh is a glycosyltransferase that catalyzes the third step in xanthan biosynthesis:

  • Substrate: GDP-mannose

  • Reaction: Adds an α-1,3-mannosyl residue to cellobiose diphosphopolyprenol, forming mannosyl-(α-1,3)-cellobiose diphosphopolyprenol .

  • Role in Xanthan Biosynthesis:
    Xanthan’s pentasaccharide repeating units require sequential glycosyltransferase activities. OpgH (GumH) is essential for constructing the lipid-linked intermediate, which is later polymerized and modified with acetyl/pyruvate groups .

Xanthan Biosynthesis and Pathogenicity

  • Strains lacking opgH fail to synthesize xanthan, leading to:

    • Loss of biofilm formation .

    • Reduced resistance to host plant defenses (e.g., glucosinolate hydrolysis products) .

    • Attenuated virulence in Brassica crops .

Comparative Analysis with Homologs

OrganismOpgh FunctionKey Difference
X. campestrisXanthan biosynthesisEssential for pathogenicity
E. coliOsmoregulated periplasmic glucan (OPG) synthesisRegulates cell division via FtsZ interaction
Caulobacter crescentusOPG synthesis; essential for cell morphology and divisionEnzymatic activity critical to prevent cell lysis

Biochemical Applications

  • Recombinant OpgH is used to study:

    • Kinetic mechanisms of glycosyltransferases .

    • Structure-function relationships in xanthan biosynthesis .

Industrial and Agricultural Relevance

  • Xanthan Production:
    OpgH’s role in xanthan biosynthesis makes it a target for optimizing industrial production of this polymer, widely used in food, pharmaceuticals, and oil recovery .

  • Disease Management:
    Inhibiting OpgH could reduce X. campestris virulence, offering a strategy for black rot disease control in crops .

Future Directions

  • Structural studies to resolve OpgH’s 3D conformation and substrate-binding pockets.

  • Engineering thermostable OpgH variants for industrial xanthan production.

  • Screening small-molecule inhibitors to block xanthan biosynthesis in pathogenic strains .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them in your order, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize its development.
Synonyms
opgH; xcc-b100_0681; Glucans biosynthesis glucosyltransferase H
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-645
Protein Length
full length protein
Species
Xanthomonas campestris pv. campestris (strain B100)
Target Names
opgH
Target Protein Sequence
MDGTVTLSPAPTDLPPVSSLDAGQPTLPPEAPLAMPEQSLREGSLQVRHQRTSPMGIGLR RFYLIGGTLTATAVAVWVMLSVLWPGGFSVLEGCLLGLFVLLFAWIAMSFASAVAGFITV VARAGRKLGIDPDAPLPSLHTRTALLMPTYNEDPRRLLAGLQAIYESVAETGQLEHFDFF VLSDTTREHIGRAEEQVYAELCDSVGGHGRIFYRRRADNAARKAGNVADWVRRFGGNYPQ MLILDADSVMTGDTIVRLVAGMEDNPDVGLIQTLPAVVNGQTLFARMQQFGGRVYGPIIA FGVAWWHGAESNYWGHNAIIRTQAFADHAGLPSLRGRKPFGGHVLSHDFVEAALMRRGGW AMHMVPYLQGSYEEGPPTLTDLLVRDRRWCQGNLQHAKVVGAKGLHWISRMHMMIGIGHY FTAPMWGMLMLVGIGIPLAGAGIDLAQGLPFSPARYWHGSSDGNAIWIFVCTMFVLLAPK LLGYIALLLNPRERRACGGAIRAALSILLETVLAALMAPVVMYLQSRGVFEVLAGKDSGW DAQVRDDGKLSWPALIRSYGGLSVFGLFMGTLAYLVSPSLAAWMAPVIVGMVVSIPVVAV TSLRRTGLALRRAGIFCIPEELDPPKVLVRASELRRAAALEPPLI
Uniprot No.

Target Background

Function
This protein is involved in the biosynthesis of osmoregulated periplasmic glucans (OPGs).
Database Links
Protein Families
Glycosyltransferase 2 family, OpgH subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What expression systems are commonly used for recombinant opgH production?

The most common expression system for recombinant Xanthomonas campestris pv. campestris opgH protein is Escherichia coli. This bacterial expression system is preferred due to:

  • High protein yield capabilities

  • Well-established protocols for induction and harvesting

  • Compatibility with His-tagging for purification

  • Cost-effectiveness for research applications

Based on available data, the full-length protein (1-645 amino acids) with an N-terminal His-tag has been successfully expressed in E. coli systems . This approach allows for effective purification using metal affinity chromatography techniques.

What are the optimal storage conditions for recombinant opgH protein?

For optimal stability and activity preservation of recombinant opgH protein, the following storage conditions are recommended:

Storage StageRecommended ConditionsNotes
Long-term storage-20°C to -80°CAliquoting is necessary for multiple use
Working stock4°CStable for up to one week
Buffer compositionTris/PBS-based buffer with 6% Trehalose, pH 8.0Maintains protein stability
Post-reconstitutionAdd 5-50% glycerol (final concentration)Default recommended concentration is 50%

Importantly, repeated freeze-thaw cycles should be avoided as they can compromise protein integrity and functionality . It is recommended to centrifuge the vial briefly before opening to bring contents to the bottom.

How should I design experiments to study opgH functional activity in vitro?

Designing robust experiments to study opgH functional activity requires careful consideration of variables and controls. A systematic approach includes:

  • Define your research question precisely: Determine whether you're investigating catalytic activity, substrate specificity, or inhibitor effects.

  • Identify variables:

    • Independent variables: Substrate concentration, enzyme concentration, pH, temperature, cofactors

    • Dependent variables: Reaction rate, product formation, substrate depletion

    • Extraneous variables to control: Buffer composition, salt concentration, presence of contaminants

  • Develop appropriate controls:

    • Negative control: Reaction mixture without enzyme

    • Positive control: Well-characterized related enzyme with known activity

    • Technical replicates: At least three replications per experimental condition

    • Biological replicates: Independent protein preparations

  • Design a factorial experiment testing multiple variables simultaneously to identify optimal conditions and potential interactions between factors .

For measuring glucosyltransferase activity specifically, consider employing radiometric assays with labeled UDP-glucose as donor substrate, or spectrophotometric assays that couple product formation to a measurable output.

What are the key challenges in expressing and purifying functional opgH protein?

Researchers face several significant challenges when expressing and purifying functional opgH protein:

  • Membrane association: The amino acid sequence reveals hydrophobic regions typical of membrane-associated proteins, which can lead to:

    • Formation of inclusion bodies

    • Reduced solubility

    • Potential misfolding

    • Aggregation during purification

  • Size considerations: At 645 amino acids, the full-length protein is relatively large, which may result in:

    • Incomplete translation

    • Truncated products

    • Expression toxicity to host cells

  • Purification optimization approaches:

    • Use mild detergents to solubilize membrane-associated regions

    • Employ gradient elution during affinity chromatography

    • Consider on-column refolding techniques

    • Optimize imidazole concentration to reduce non-specific binding

  • Activity preservation: Buffer composition is critical, with Tris/PBS-based buffer containing 6% Trehalose at pH 8.0 showing good results for maintaining stability .

Researchers should consider starting with expression of specific domains rather than the full-length protein if encountering persistent solubility issues.

How can I design comparative studies between opgH from different Xanthomonas species?

When designing comparative studies of opgH proteins from different Xanthomonas species, implement the following methodological approach:

  • Sequence analysis phase:

    • Perform multiple sequence alignment to identify conserved and variable regions

    • Construct phylogenetic trees to visualize evolutionary relationships

    • Identify species-specific domains or motifs

  • Experimental design considerations:

    • Use identical expression systems and purification protocols

    • Express proteins under identical conditions

    • Apply between-subjects experimental design with controlled variables

    • Include technical replicates (n≥3) for each species variant

  • Functional comparison methods:

    • Enzymatic activity assays with standardized substrates

    • Thermal stability assessments

    • Substrate specificity profiles

    • Inhibitor sensitivity tests

  • Data analysis approach:

    • Employ statistical methods appropriate for between-group comparisons

    • Use ANOVA for multi-species comparisons

    • Calculate kinetic parameters (Km, Vmax) for quantitative comparison

    • Normalize data to account for expression level differences

What role does opgH play in Xanthomonas virulence, and how can this be investigated experimentally?

The opgH protein (Glucans biosynthesis glucosyltransferase H) plays several potential roles in Xanthomonas virulence that can be investigated through structured experimental approaches:

  • Hypothesized virulence mechanisms:

    • Contribution to biofilm formation

    • Role in exopolysaccharide (EPS) synthesis

    • Involvement in plant-pathogen interactions

    • Possible function in osmotic stress response

  • Experimental investigation methodology:

    • Gene knockout studies: Create opgH deletion mutants and assess:

      • Virulence in plant infection models

      • Biofilm formation capacity

      • Stress tolerance profiles

      • Exopolysaccharide production

    • Complementation experiments: Reintroduce wild-type or mutated opgH to confirm phenotypes

    • Site-directed mutagenesis: Target key catalytic residues to assess enzymatic activity contribution to virulence

    • Transcriptomic analysis: Compare gene expression profiles between wild-type and opgH mutants during infection

  • Experimental design considerations:

    • Implement true experimental design with proper controls

    • Use randomization to minimize bias

    • Include appropriate sample sizes for statistical power

    • Control environmental variables that might influence virulence

This multi-faceted approach provides a comprehensive understanding of opgH's role in pathogenesis while establishing causative relationships through controlled experimental manipulation.

How can structural analysis of opgH inform inhibitor design for antimicrobial development?

Structural analysis of opgH can guide rational inhibitor design through the following methodological approach:

  • Structural determination techniques:

    • X-ray crystallography of purified recombinant opgH protein

    • Cryo-electron microscopy for membrane-associated conformations

    • Homology modeling based on related glucosyltransferases

    • Molecular dynamics simulations to identify flexible regions

  • Structure-based drug design workflow:

    • Identify catalytic pocket and substrate binding sites

    • Characterize the electrostatic surface potential

    • Map conserved regions across bacterial species

    • Locate species-specific structural features for selectivity

  • Virtual screening methodology:

    • Develop a validated docking protocol

    • Screen compound libraries against identified binding sites

    • Rank compounds based on predicted binding energy

    • Select diverse chemical scaffolds for experimental validation

  • Experimental validation approach:

    • Enzymatic inhibition assays with recombinant protein

    • Thermal shift assays to confirm binding

    • Structure-activity relationship studies

    • Evaluation of antimicrobial activity against whole cells

This comprehensive approach integrates computational and experimental techniques to develop potential inhibitors targeting opgH as a novel antimicrobial strategy.

What are the recommended approaches for analyzing the interaction between opgH and potential binding partners?

To systematically investigate interactions between opgH and potential binding partners, researchers should employ a multi-technique approach:

  • In silico prediction methods:

    • Protein-protein interaction prediction algorithms

    • Molecular docking simulations

    • Co-evolution analysis across bacterial species

    • Genomic context analysis (gene neighborhood)

  • Physical interaction detection techniques:

    TechniqueAdvantagesLimitationsBest Application
    Pull-down assaysIdentifies direct interactionsMay miss transient interactionsInitial screening
    Co-immunoprecipitationWorks with endogenous proteinsRequires specific antibodiesVerification in native context
    Surface plasmon resonanceQuantitative binding kineticsRequires purified proteinsAffinity determination
    Isothermal titration calorimetryThermodynamic parametersSample intensiveDetailed binding characterization
    Crosslinking mass spectrometryIdentifies interaction interfacesComplex data analysisStructural mapping
  • Experimental design considerations:

    • Include appropriate negative controls (non-specific proteins)

    • Use protein variants with mutations in predicted interaction sites

    • Control for tag interference in binding studies

    • Validate interactions through multiple independent techniques

    • Design systematic variable manipulation to establish causality

  • Functional validation approaches:

    • Co-localization studies in bacterial cells

    • Bacterial two-hybrid systems

    • Effects of mutations on complex formation

    • Impact of binding partner knockouts on opgH function

This comprehensive strategy ensures robust identification and characterization of genuine opgH interaction partners while minimizing false positives.

What are common issues in recombinant opgH production and how can they be addressed?

Researchers frequently encounter several challenges when producing recombinant opgH protein. The following table outlines common issues and their methodological solutions:

IssuePossible CausesRecommended Solutions
Low expression yieldCodon bias, toxicity to host cellsOptimize codon usage, use specialized expression strains, employ tightly controlled inducible promoters
Inclusion body formationHydrophobic regions, improper foldingLower induction temperature (16-20°C), reduce inducer concentration, co-express chaperones
Protein degradationProtease activity, instabilityAdd protease inhibitors, optimize buffer conditions, use protease-deficient strains
Low solubilityMembrane-associated regionsAdd mild detergents, use fusion partners (MBP, SUMO), optimize salt concentration
Protein aggregationImproper disulfide formation, hydrophobic interactionsInclude reducing agents, optimize pH, add stabilizing agents like Trehalose (6%)
Loss during purificationNon-specific binding, precipitationOptimize imidazole gradient, include glycerol in buffers, filter solutions before chromatography

When working with opgH, particularly note that the storage recommendations include avoiding repeated freeze-thaw cycles and maintaining working aliquots at 4°C for no more than one week . For reconstitution, centrifuge the vial briefly before opening and use deionized sterile water to achieve a concentration of 0.1-1.0 mg/mL, adding 5-50% glycerol for long-term storage stability.

How should researchers design experiments to investigate opgH enzymatic kinetics?

When investigating opgH enzymatic kinetics, researchers should implement a systematic experimental design approach:

  • Pre-experimental planning:

    • Clearly define research questions about specific kinetic parameters

    • Formulate testable hypotheses about substrate preferences or inhibition patterns

    • Identify all variables that need control (pH, temperature, cofactors)

  • Experimental setup:

    • Independent variables: Substrate concentrations (at least 7-8 different concentrations spanning 0.2× to 5× Km)

    • Dependent variables: Initial reaction velocity

    • Controls: No-enzyme controls, heat-inactivated enzyme controls

    • Replicates: Minimum of triplicate measurements for each condition

  • Methodological approach:

    • Use purified recombinant opgH (>90% purity as determined by SDS-PAGE)

    • Ensure consistent enzyme concentration across assays

    • Maintain temperature control (±0.5°C)

    • Measure initial rates only (typically <10% substrate conversion)

    • Include time-course studies to confirm linearity of initial rates

  • Data analysis workflow:

    • Plot initial velocity vs. substrate concentration

    • Fit data to appropriate enzyme kinetic models:

      • Michaelis-Menten equation for simple kinetics

      • Allosteric models if cooperativity is observed

      • Competitive/non-competitive models for inhibition studies

    • Use non-linear regression rather than linearization methods

    • Calculate and report key parameters (Km, Vmax, kcat, catalytic efficiency)

This systematic approach ensures reliable determination of kinetic parameters while controlling for variables that could confound results.

What considerations are important when designing site-directed mutagenesis experiments for opgH functional studies?

When designing site-directed mutagenesis experiments to study opgH function, researchers should implement the following methodological approach:

  • Target selection strategy:

    • Conduct sequence conservation analysis across bacterial species

    • Identify putative catalytic residues based on related glucosyltransferases

    • Locate residues in predicted binding sites or functional domains

    • Consider charged residues at the protein surface for potential interaction sites

  • Mutation design principles:

    • Conservative mutations: Replace with physicochemically similar amino acids to test specific chemical properties

    • Non-conservative mutations: Create more dramatic changes to test essential nature of residues

    • Alanine scanning: Systematically replace residues with alanine to identify critical positions

    • Structure-guided mutations: Target specific structural features (loops, helices)

  • Experimental design considerations:

    • Generate multiple mutants in parallel for comparative analysis

    • Include wild-type controls in every experiment

    • Design true experimental structures with appropriate randomization

    • Control for expression level differences between mutants

    • Use site-directed mutants with catalytic mutations as negative controls

  • Functional assay selection:

    • Enzymatic activity measurements

    • Substrate binding assays

    • Thermal stability assessments

    • Protein-protein interaction studies

    • Cellular localization experiments

  • Data analysis approach:

    • Normalize mutant activities to wild-type levels

    • Use statistical tests appropriate for multiple comparisons

    • Create structure-function relationship maps

    • Correlate findings with available structural information

This comprehensive approach ensures that mutagenesis experiments yield meaningful insights into opgH function while controlling for experimental variables that could confound interpretation.

How can opgH be utilized as a target for developing phage-based biocontrol strategies against Xanthomonas infections?

Exploiting opgH as a target for phage-based biocontrol involves several interconnected research approaches:

  • Target validation methodology:

    • Confirm opgH accessibility at the bacterial surface

    • Verify expression levels during plant infection

    • Assess conservation across Xanthomonas strains

    • Determine essentiality through knockout studies

  • Phage selection strategy:

    • Screen phage libraries for binding to recombinant opgH

    • Perform biopanning against live Xanthomonas cells

    • Select for phages with high specificity and binding affinity

    • Evaluate binding to different bacterial growth phases

  • Experimental design for efficacy testing:

    • Implement factorial experiments testing multiple variables:

      • Phage concentration

      • Bacterial strain diversity

      • Application timing

      • Environmental conditions

    • Use randomized complete block design for field trials

    • Include appropriate controls (untreated, chemical standards)

    • Measure multiple outcome variables (infection rate, crop yield)

  • Resistance development assessment:

    • Design long-term exposure experiments

    • Monitor mutation rates in opgH gene

    • Evaluate fitness costs of resistance

    • Develop phage cocktails targeting multiple epitopes

This systematic approach addresses both the fundamental biology and applied aspects of using opgH as a biocontrol target while employing robust experimental design principles.

What are the recommended methods for comparing opgH function across different environmental conditions?

To comprehensively investigate opgH function across varying environmental conditions, researchers should employ the following methodological framework:

  • Environmental parameter selection:

    • Identify ecologically relevant conditions:

      • Temperature ranges (15-40°C)

      • pH variations (5.0-8.0)

      • Osmotic stress levels

      • Nutrient limitations

      • Plant host-derived signals

  • Experimental design approach:

    • Implement factorial design to test interaction effects

    • Use response surface methodology to map optimal conditions

    • Include time-course measurements to capture dynamic responses

    • Maintain adequate biological and technical replication

    • Apply randomization principles to minimize bias

  • Measurement methodologies:

    ParameterTechniqueOutcome Measure
    Gene expressionqRT-PCR, RNA-seqTranscript levels
    Protein abundanceWestern blot, proteomicsProtein quantity
    Enzymatic activityIn vitro assaysReaction rates
    LocalizationFluorescent taggingCellular distribution
    Post-translational modificationsMass spectrometryModification profiles
  • Data analysis framework:

    • Apply multivariate statistical methods

    • Develop predictive models of opgH function

    • Use principal component analysis to identify key variables

    • Perform hierarchical clustering of conditions

    • Validate findings across multiple Xanthomonas strains

This comprehensive approach allows researchers to understand how environmental factors modulate opgH function while adhering to robust experimental design principles.

How should researchers approach the development of high-throughput screening assays for opgH inhibitors?

Developing effective high-throughput screening (HTS) assays for opgH inhibitors requires careful methodological planning:

  • Assay development strategy:

    • Primary considerations:

      • Choose between enzymatic or binding assays

      • Optimize signal-to-background ratio (>3:1)

      • Ensure reproducibility (CV <15%)

      • Develop miniaturized format (384 or 1536-well)

      • Select detection method compatible with automation

    • Assay types and their applications:

      Assay TypeDetection MethodAdvantagesLimitations
      Enzymatic activityFluorescence, luminescenceDirect functional relevanceRequires substrate optimization
      Thermal shiftFluorescent dyesDetects all bindersIndirect measure of inhibition
      Surface plasmon resonanceOpticalReal-time kineticsLower throughput
      AlphaScreenLuminescenceHomogeneous formatPotential interference
      Fluorescence polarizationFluorescenceSimple setupRequires fluorescent ligands
  • Experimental design for HTS:

    • Implement statistical design of experiments for optimization

    • Include appropriate controls in every plate:

      • Positive controls (known inhibitors)

      • Negative controls (vehicle only)

      • Enzyme-free controls

    • Randomize compound placement to minimize positional effects

    • Include technical replicates for hit confirmation

  • Validation cascade methodology:

    • Confirm hits in duplicate or triplicate

    • Counter-screen against related enzymes

    • Evaluate dose-response relationships

    • Assess mechanism of inhibition

    • Test activity against live bacteria

  • Data analysis workflow:

    • Calculate Z' factor to assess assay quality (target >0.5)

    • Apply appropriate statistical methods for hit identification

    • Use cluster analysis to identify structural patterns among hits

    • Implement machine learning for predictive models

This systematic approach ensures the development of robust, scalable assays for opgH inhibitor discovery while adhering to principles of good experimental design.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.