Recombinant Xanthomonas campestris pv. campestris Lipid A export ATP-binding/permease protein MsbA (msbA)

Shipped with Ice Packs
In Stock

Description

Introduction

Recombinant Xanthomonas campestris pv. campestris Lipid A export ATP-binding/permease protein MsbA (msbA) is a critical bacterial membrane transporter belonging to the ATP-binding cassette (ABC) superfamily. It facilitates the energy-dependent flipping of lipid A, a key component of lipopolysaccharides (LPS), from the cytoplasmic to the periplasmic leaflet of the inner membrane . This process is essential for outer membrane biogenesis in Gram-negative bacteria, including pathogenic strains like Xanthomonas campestris, which causes black rot in cruciferous crops . Recombinant MsbA is engineered for structural, functional, and biochemical studies to elucidate its role in bacterial survival and antibiotic resistance .

Protein Architecture

MsbA functions as a homodimer, with each subunit containing:

  • Transmembrane domains (TMDs): Form the lipid A translocation pathway .

  • Nucleotide-binding domains (NBDs): Bind and hydrolyze ATP to drive conformational changes .

Substrate Recognition and Mechanism

  • LPS Binding: Cryo-EM structures reveal LPS binds deeply within the TMDs via hydrophilic/hydrophobic interactions, with glucosamine phosphates anchoring the molecule .

  • Conformational Dynamics: ATP hydrolysis drives transitions between inward-facing (cytoplasmic) and closed (periplasmic) states to flip LPS .

Pathogenicity and Membrane Integrity

MsbA is critical for:

  • Outer Membrane Biogenesis: LPS transport ensures membrane stability, a prerequisite for virulence in plant pathogens .

  • Antibiotic Resistance: As an ABC efflux pump, MsbA contributes to multidrug resistance by expelling nitroimidazole antibiotics .

Regulatory Interactions

  • TrxA Binding: Thioredoxin (TrxA) modulates MsbA dynamics by neutralizing electrostatic interactions between MsbA’s basic helix 2 and membrane cardiolipin, facilitating LPS release .

  • DNA Binding: PSB15, a phage packaging signal-binding protein, interacts with MsbA to regulate membrane dissociation during phage assembly .

Antibiotic Development

  • Drug Efflux Target: MsbA’s role in antibiotic resistance makes it a candidate for inhibitors to potentiate existing therapies .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we have in stock. However, if you have specific format requirements, please include them in your order remarks. We will fulfill your requests to the best of our ability.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please contact your local distributors for specific delivery times.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please communicate with us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer ingredients, temperature, and the inherent stability of the protein itself.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
msbA; XC_1995; ATP-dependent lipid A-core flippase; Lipid A export ATP-binding/permease protein MsbA
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-589
Protein Length
full length protein
Species
Xanthomonas campestris pv. campestris (strain 8004)
Target Names
msbA
Target Protein Sequence
MKTINENAPQVSSWQTYRRLLAFAKPYRLLLVAALIAALIEAAGTTGFLALMKPITDETF IYKNAEVSRWLPVQIILLFVIRGAAGYITDMAMGKSARSIARDLRVKVMSKYLRLPGSRF DSEPVPSMLIRLGSDSDQVAQAAVDAVKVMIQQSLQVIGALALMLWHSWQVTLTILVLAP VLAWVMDKVARRYRRISHSIQESGAHLLQAADQTLSSHQEVKIYGAQQSEMERYSGLADR NLRLAMKVESTRGISTATVQMIGAIGLSALLFVAGAQALAGRLTAGDFVVLMTSMLTIIP GLKQLTNVQNMVQRGLASAERLFSVLDSPDEPDQGQVPLTRAKGLIEFRDVTARYPGQAN PALADVSFVAQPGTVTAIVGRSGSGKSSLIKLIPRFYEAESGQILLDGHPVQAYALADLR RQIALVGQQVMLFDGSIAENVAYGEMRQCDAGQLERAIQGANAMEFVAQLPEGLQSHVGT KGGRLSGGQRQRLAIARAMLKDAPILILDEATAALDNESERLVQDALHKLMPDRTTLVIA HRLSTIEHADQVLVMDQGRIVERGTHQELLALGGLYSHLHGMQFRERQA
Uniprot No.

Target Background

Function
This protein is involved in lipopolysaccharide (LPS) biosynthesis. It facilitates the translocation of lipid A-core from the inner to the outer leaflet of the inner membrane. Transmembrane domains (TMD) form a pore in the inner membrane, and the ATP-binding domain (NBD) is responsible for energy generation.
Database Links

KEGG: xcb:XC_1995

STRING: 314565.XC_1995

Protein Families
ABC transporter superfamily, Lipid exporter (TC 3.A.1.106) family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is MsbA and what is its primary function in Xanthomonas campestris?

MsbA is an ATP-binding cassette (ABC) transporter that plays a crucial role in lipopolysaccharide (LPS) biogenesis in Gram-negative bacteria, including Xanthomonas campestris pv. campestris. Its primary function is facilitating the transport of the LPS precursor lipooligosaccharide (LOS) from the cytoplasmic to the periplasmic leaflet of the inner membrane. This translocation process is essential for the proper assembly of the outer membrane, which provides bacteria with resistance against antibiotics and various environmental stresses . As a member of the ABC transporter superfamily, MsbA couples ATP hydrolysis to substrate translocation across the membrane, participating in a critical aspect of bacterial envelope biogenesis.

What is the molecular structure and key features of MsbA protein?

The MsbA protein from Xanthomonas campestris pv. campestris (strain 8004) is a full-length protein consisting of 589 amino acids (UniProt accession: Q4UV65). The protein contains characteristic structural elements of ABC transporters, including:

  • Transmembrane domains (TMDs) that form a pathway for substrate translocation

  • Nucleotide-binding domains (NBDs) that bind and hydrolyze ATP

  • Coupling helices that transmit conformational changes between the TMDs and NBDs

Structural studies have captured MsbA in multiple conformational states, including open inward-facing and open outward-facing conformations, reflecting different stages of the transport cycle . These conformational changes are critical for understanding how MsbA facilitates substrate translocation across the membrane.

Table 1: Key Structural Features of Xanthomonas campestris MsbA Protein

FeatureDescriptionFunctional Significance
Transmembrane domainsMembrane-spanning helicesForm substrate translocation pathway
Nucleotide-binding domainsConserved ATP-binding cassettesProvide energy through ATP hydrolysis
Coupling helicesConnect TMDs to NBDsTransmit conformational changes
Substrate binding pocketLocated within TMDsRecognition and binding of lipid A substrates
ATP-binding motifsWalker A, Walker B, and signature motifsEssential for ATP binding and hydrolysis

How is MsbA involved in bacterial lipopolysaccharide biogenesis?

MsbA functions as a lipid flippase that translocates the LPS precursor lipid A across the inner membrane. This is a critical step in the multistage process of LPS biogenesis. Native mass spectrometry studies have shown that MsbA can specifically interact with Kdo2-lipid A (KDL), an LPS precursor . The translocation process involves several distinct conformational states:

  • In the resting state, MsbA adopts an inward-facing conformation with its substrate-binding pocket accessible from the cytoplasmic side.

  • Upon binding lipid A, the protein undergoes conformational changes.

  • ATP binding to the NBDs promotes dimerization and transition to an outward-facing state.

  • This conformational change facilitates the release of the substrate into the periplasmic leaflet.

  • Subsequent ATP hydrolysis resets the transporter to its inward-facing conformation.

Recent structural studies at 2.7 Å resolution have captured MsbA in an open, outward-facing conformation bound to KDL at the exterior site, providing valuable insights into this transport mechanism .

What are the optimal conditions for expressing and purifying recombinant Xanthomonas campestris MsbA?

Successful expression and purification of functional MsbA require careful optimization of conditions due to its membrane protein nature. Based on established protocols for ABC transporters and the specific information for Xanthomonas campestris MsbA:

Expression System:

  • Host: E. coli strains optimized for membrane protein expression (C41(DE3), C43(DE3), or LEMO21(DE3))

  • Vector: pET series with an N-terminal or C-terminal affinity tag (His6 or His10)

  • Induction: 0.1-0.5 mM IPTG at 18-20°C for 16-20 hours to minimize inclusion body formation

Purification Protocol:

  • Membrane isolation through differential centrifugation

  • Solubilization using mild detergents (DDM, LMNG, or UDM at 1-2% w/v)

  • Immobilized metal affinity chromatography (IMAC)

  • Size exclusion chromatography for final purity

Storage Conditions:

  • Store purified protein in Tris-based buffer with 50% glycerol at -20°C for short-term or -80°C for extended storage

  • Avoid repeated freeze-thaw cycles

  • For working stocks, store aliquots at 4°C for up to one week

How can native mass spectrometry be applied to study MsbA-nucleotide and MsbA-lipid interactions?

Native mass spectrometry (MS) has emerged as a powerful tool for investigating protein-ligand interactions while maintaining their non-covalent complexes. For studying MsbA:

  • Sample Preparation:

    • Purify MsbA in MS-compatible detergents (e.g., C8E4) or amphipols

    • Exchange into volatile buffers (e.g., ammonium acetate)

    • Carefully adjust detergent concentration to maintain protein structure while minimizing MS signal suppression

  • Key MS Parameters:

    • Use gentle ionization conditions to preserve non-covalent interactions

    • Optimize cone voltage and collision energy for intact complex detection

    • Employ high-resolution instruments (e.g., Q-TOF or Orbitrap) for accurate mass determination

  • Binding Experiments:

    • Titrate nucleotides (ATP, ADP) or lipid substrates (KDL) at varying concentrations

    • Monitor shifts in mass-to-charge ratios corresponding to ligand binding

    • Calculate binding affinities from concentration-dependent measurements

This approach has successfully demonstrated that MsbA has a higher affinity for ADP compared to ATP, and that the LPS-precursor KDL can modulate MsbA's nucleotide selectivity, tuning its preference toward ATP over ADP . These findings provide critical insight into how lipid substrates might regulate the ATPase activity of MsbA during the transport cycle.

What structural biology techniques are most effective for studying MsbA conformations?

Multiple structural biology techniques have been employed to capture different conformational states of MsbA during its transport cycle. Each offers distinct advantages:

Table 2: Structural Biology Techniques for MsbA Research

TechniqueResolutionAdvantagesLimitationsNotable Findings
X-ray Crystallography2.5-3.5 ÅHigh resolution, atomic detailsChallenging for membrane proteins, crystal packing artifactsCaptured various conformational states including nucleotide-bound forms
Cryo-electron Microscopy2.7-4.0 ÅNear-native conditions, conformational heterogeneitySample preparation challengesRevealed open outward-facing conformation with KDL bound
DEER/EPR Spectroscopy20-40 Å (distance measurements)Dynamic information in solution, conformational distributionsLower resolution, requires labelingMeasured distances between domains during conformational changes
Hydrogen-Deuterium Exchange MSPeptide-levelDynamics and solvent accessibilityIndirect structural informationIdentified regions undergoing conformational changes upon substrate binding

Recent high-resolution (2.7 Å) cryo-EM structures have been particularly valuable, capturing MsbA in an open outward-facing conformation with KDL bound at the exterior site and the NBDs adopting a distinct nucleotide-free structure . Such snapshots provide crucial insights into the transport mechanism.

How does lipid binding modulate the nucleotide selectivity and transport activity of MsbA?

Recent native MS studies have revealed a fascinating interplay between lipid binding and nucleotide preference in MsbA. The data show that:

  • In the absence of lipid substrate, MsbA exhibits higher affinity for ADP compared to ATP.

  • When bound to the LPS-precursor KDL, MsbA's nucleotide selectivity shifts, with increased preference for ATP over ADP .

This lipid-induced modulation of nucleotide preference suggests a sophisticated regulatory mechanism where substrate binding promotes ATP utilization, potentially optimizing energy expenditure during the transport cycle. The lipid substrate appears to act as an allosteric regulator that primes the transporter for ATP binding and subsequent conformational changes required for translocation.

Mechanistically, this may occur through:

  • KDL binding inducing conformational changes in the transmembrane domains

  • These changes being transmitted to the NBDs via the coupling helices

  • Altered positioning of key residues in the ATP-binding pocket

  • Enhanced ATP binding affinity and/or reduced ADP affinity

This phenomenon demonstrates how MsbA integrates substrate recognition with nucleotide utilization, ensuring energetic efficiency in the transport process.

What are the conformational changes observed during the MsbA transport cycle?

Structural studies have revealed multiple conformational states of MsbA that provide snapshots of its transport cycle:

  • Inward-facing open conformations: Four distinct inward-facing structures have been observed, varying in their degree of openness. These conformations expose the substrate-binding pocket to the cytoplasmic side, allowing lipid A recognition and binding .

  • Nucleotide-bound transition state: Upon ATP binding, the NBDs dimerize, initiating closure of the inward-facing cavity and rotation of the transmembrane helices.

  • Outward-facing conformation: A high-resolution (2.7 Å) structure shows MsbA in an open, outward-facing state with KDL bound at the exterior site and the NBDs adopting a distinct nucleotide-free structure. This conformation represents a state where the substrate has been translocated and is accessible to the periplasmic leaflet .

  • Post-hydrolysis state: Following ATP hydrolysis, the NBDs separate, and the transporter resets to the inward-facing conformation to begin a new cycle.

These conformational transitions reflect an alternating access mechanism, where the substrate binding site alternately faces the cytoplasmic and periplasmic sides of the membrane during transport. The energy from ATP binding and hydrolysis drives these conformational changes, coupling nucleotide hydrolysis to substrate translocation.

How does MsbA from Xanthomonas campestris compare with homologs from other bacterial species?

MsbA is conserved across Gram-negative bacteria, but with notable sequence and functional variations:

Table 3: Comparison of MsbA Homologs Across Bacterial Species

SpeciesSequence Identity to X. campestris MsbAKey Functional DifferencesStructural Variations
E. coli~65-70%Well-characterized lipid A transporterMore extensively studied structurally
Salmonella typhimurium~65%Similar substrate specificitySubtle differences in NBD organization
Pseudomonas aeruginosa~60%May transport additional substratesDifferences in substrate binding pocket
Vibrio cholerae~58%Adapted to specific LPS variantsVariations in transmembrane helices

Genetic diversity studies using techniques like multilocus sequence typing (MLST) and repetitive DNA sequence-based PCR (rep-PCR) have revealed considerable variation within Xanthomonas campestris strains . These genetic analyses have identified at least 12 distinct allelic profiles, with the largest group (AP1) containing 32 strains . This genetic diversity likely extends to the MsbA protein, potentially resulting in functional variations that might affect substrate specificity, transport efficiency, or regulatory mechanisms.

Comparative studies of MsbA across different bacterial species and strains provide valuable insights into the evolutionary adaptations of this essential transporter and could inform targeted inhibitor design strategies.

How can contradictory results in MsbA structural studies be reconciled?

Researchers studying MsbA often encounter seemingly contradictory structural data, particularly regarding conformational states and nucleotide binding. These discrepancies typically arise from:

  • Different experimental conditions: Detergent choice, lipid composition, and buffer conditions can dramatically affect MsbA conformation and stability.

  • Crystal packing artifacts: In X-ray crystallography, contacts between protein molecules in the crystal lattice can stabilize non-physiological conformations.

  • Trapped intermediates: Different techniques may capture distinct intermediates within the transport cycle rather than contradictory structures.

  • Species-specific variations: Structural differences between MsbA orthologs from different bacterial species.

To reconcile these discrepancies, a multi-technique approach is recommended:

  • Validate structural findings using complementary methods (e.g., EPR, SAXS, or HDX-MS)

  • Perform functional assays to correlate structural states with transport activity

  • Use molecular dynamics simulations to explore conformational transitions and energy landscapes

  • Consider the native lipid environment's role in stabilizing physiologically relevant conformations

By integrating data from multiple experimental approaches and considering the dynamic nature of ABC transporters, researchers can build a more coherent understanding of MsbA's structure-function relationships.

What methodological approaches can address the challenges in studying membrane protein dynamics like those of MsbA?

Studying the dynamics of membrane proteins like MsbA presents unique challenges due to their hydrophobic nature and conformational flexibility. Several methodological approaches can overcome these limitations:

  • Time-resolved structural methods:

    • Time-resolved cryo-EM to capture conformational intermediates

    • Time-resolved X-ray crystallography with photo-caged ATP analogs

    • Single-molecule FRET to monitor conformational changes in real-time

  • Advanced simulation approaches:

    • Enhanced sampling molecular dynamics (e.g., metadynamics, replica exchange)

    • Coarse-grained simulations for longer timescale events

    • Markov state modeling to identify metastable conformational states

  • Integrated structural biology:

    • Combine high-resolution static structures with dynamic information from EPR or NMR

    • Validate computational models with experimental constraints

    • Apply hybrid methods that integrate data from multiple techniques

  • Native-like membrane environments:

    • Nanodiscs or lipid cubic phase for maintaining native lipid interactions

    • Cell-free expression in the presence of liposomes

    • In-cell structural studies using genetic code expansion for probe incorporation

These approaches can provide a more comprehensive understanding of MsbA's conformational dynamics during the transport cycle and reveal how lipid and nucleotide binding modulate its function.

How might genetic diversity in Xanthomonas campestris impact MsbA function and antibiotic resistance?

Genetic diversity studies have revealed significant variation among Xanthomonas campestris strains, with multilocus sequence typing (MLST) identifying 12 distinct allelic profiles and repetitive DNA sequence-based PCR (rep-PCR) distinguishing 14 DNA groups . This genetic diversity raises important questions about potential functional variations in the MsbA transporter:

  • Strain-specific MsbA variants: Different alleles might encode MsbA proteins with altered substrate specificity, transport efficiency, or regulatory mechanisms.

  • Correlation with virulence: The main pathotype in China (AP1/DNA I group) differs from previously reported type races in both genotype and virulence . These differences could partially result from variations in LPS structure and transport through MsbA.

  • Impact on antibiotic resistance: Since MsbA contributes to outer membrane integrity by facilitating LPS transport, variations in MsbA function could influence susceptibility to antibiotics that target Gram-negative bacteria.

Future research should investigate:

  • Sequence variations in MsbA across different Xanthomonas campestris strains

  • Functional characterization of strain-specific MsbA variants

  • Correlation between MsbA sequence variation and antibiotic resistance profiles

  • Potential of MsbA as a target for strain-specific antimicrobial development

Understanding the relationship between genetic diversity and MsbA function could provide insights into bacterial adaptation mechanisms and inform targeted therapeutic approaches.

What emerging techniques might advance our understanding of MsbA structure-function relationships?

Several cutting-edge techniques show promise for providing new insights into MsbA biology:

  • Cryo-electron tomography (cryo-ET) can visualize MsbA in its native membrane environment, potentially revealing how it interacts with other LPS biosynthesis machinery.

  • AlphaFold2 and other AI-based structure prediction tools could help model strain-specific variations in MsbA structure and predict their functional consequences.

  • Microfluidics-based approaches may enable high-throughput screening of conditions that affect MsbA conformational states or transport activity.

  • In-cell NMR and EPR could provide insights into MsbA dynamics in intact bacteria, offering a more physiologically relevant view of its function.

  • CRISPR-based genetic screens might identify previously unknown factors that modulate MsbA function or reveal synthetic lethal interactions that could be exploited therapeutically.

These emerging techniques, combined with established structural and functional approaches, have the potential to significantly advance our understanding of how MsbA facilitates lipid transport and contributes to bacterial membrane biogenesis.

How can structural information about MsbA be leveraged for antimicrobial development?

The essential role of MsbA in LPS transport and outer membrane biogenesis makes it an attractive target for novel antimicrobial development. High-resolution structural information, particularly the 2.7 Å structure showing MsbA in an outward-facing conformation with bound KDL , provides valuable templates for structure-based drug design approaches.

Potential strategies include:

  • ATP-binding site inhibitors: Compounds that compete with ATP binding or prevent NBD dimerization could block the transport cycle.

  • Substrate-binding pocket modulators: Molecules that mimic lipid A structure but cannot be transported might act as competitive inhibitors.

  • Allosteric inhibitors: Compounds that bind to regions outside the active sites and stabilize inactive conformations or prevent conformational changes.

  • Conformation-specific inhibitors: Drugs designed to trap MsbA in specific conformational states, preventing completion of the transport cycle.

The diverse conformational states captured in structural studies provide multiple potential targeting opportunities. Additionally, comparative analysis of MsbA structures across different bacterial species could reveal species-specific features that might be exploited for selective targeting.

By focusing antimicrobial development efforts on this essential transporter, researchers may identify novel compounds effective against multidrug-resistant Gram-negative pathogens.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.