Recombinant Xanthomonas campestris pv. campestris Lipoprotein signal peptidase (lspA)

Shipped with Ice Packs
In Stock

Description

Biosynthesis and Recombinant Production

Recombinant LspA is generated by cloning the lspA gene into E. coli expression vectors. Post-induction, the protein is purified via affinity chromatography leveraging the His-tag. Key production parameters include:

  • Reconstitution: Solubilized in deionized sterile water (0.1–1.0 mg/mL) with 5–50% glycerol for long-term storage .

  • Yield: Optimized for high-density bacterial cultures, ensuring scalability for industrial and research applications .

Functional Role in X. campestris Pathogenesis

LspA is indispensable for processing lipoproteins, which are vital for:

  • Membrane integrity: Proper anchoring of lipoproteins to the outer membrane .

  • Virulence: Lipoproteins contribute to evasion of plant immune responses, such as suppression of reactive oxygen species (ROS) and callose deposition .

  • Secretion systems: Lipoproteins assist in Type III secretion system (T3SS) function, enabling delivery of effector proteins like XopL, which disrupts host immunity .

Inactivation of lipoprotein-processing systems (e.g., LolA/LolB) reduces pathogenicity, underscoring LspA’s role in virulence .

Key Studies

  • Enzymatic activity: Recombinant LspA retains catalytic function, cleaving signal peptides from prolipoproteins in vitro .

  • Structural insights: Crystal structures of homologous proteins (e.g., LolA-LolB complexes) reveal interaction interfaces critical for lipoprotein transport .

  • Pathogenicity links: Mutants lacking functional lipoproteins show attenuated virulence in Arabidopsis and tomato models .

Comparative Genomics

Non-pathogenic Xanthomonas melonis strains lack the wxc LPS biosynthesis cluster but retain lspA, suggesting LspA’s role extends beyond LPS-dependent virulence .

Industrial and Agricultural Relevance

  • Antimicrobial targets: LspA inhibitors could disrupt bacterial membrane biogenesis, offering novel disease control strategies .

  • Biotechnological tools: Recombinant LspA is used to study lipoprotein maturation in genetically engineered Xanthomonas strains .

Challenges and Future Directions

  • Mechanistic details: How LspA cooperates with LolA/LolB during lipoprotein trafficking remains unclear .

  • Host interactions: Further studies are needed to map LspA’s role in suppressing salicylic acid (SA)-mediated plant defenses .

Product Specs

Form
Lyophilized powder
Please note: We will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them in your order notes. We will prepare your order according to your specifications.
Lead Time
Delivery time may vary depending on the purchase method or location. Please consult your local distributor for specific delivery timeframes.
Please note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal stability, store working aliquots at 4°C for up to one week.
Reconstitution
Prior to opening, we recommend briefly centrifuging the vial to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by multiple factors, including storage conditions, buffer components, storage temperature, and the intrinsic stability of the protein itself.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize the development of that tag.
Synonyms
lspA; XC_3086; Lipoprotein signal peptidase; Prolipoprotein signal peptidase; Signal peptidase II; SPase II
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-167
Protein Length
full length protein
Species
Xanthomonas campestris pv. campestris (strain 8004)
Target Names
lspA
Target Protein Sequence
MSQRPNPSALIWLLLSAVVIGLDQWSKAWVLSSLPEYTPVPVIDGFWNWYRTYNTGAAFS FLSDAGGWQLWFFTALAVGISGLLAFWLSRTARGDWRSAVPYALVIGGAIGNVIDRLMHG HVVDFIQWYVGEHTWPSFNIADSAIVGGAIGIALFGLFDGKRSRKAG
Uniprot No.

Target Background

Function
This protein specifically catalyzes the removal of signal peptides from prolipoproteins.
Database Links

KEGG: xcb:XC_3086

STRING: 314565.XC_3086

Protein Families
Peptidase A8 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

How do lspA, lgt, and lepB coordinate in the lipoprotein processing pathway?

The lipoprotein maturation pathway involves three key enzymes that work sequentially:

  • Lgt (prolipoprotein diacylglyceryl transferase) - Transfers a diacylglyceryl moiety to the conserved cysteine residue in the lipobox motif of the prolipoprotein

  • LspA (lipoprotein signal peptidase) - Cleaves the signal peptide just before the modified cysteine

  • LolA/LolB system - Facilitates the transfer of processed lipoproteins to their final destination

This differential expression pattern is likely similar in Xcc, suggesting that while lspA is essential for processing certain critical lipoproteins, it affects a relatively small subset of the total secretory proteome.

What methods can be used to clone and express recombinant lspA from Xanthomonas campestris pv. campestris?

Based on protocols used for similar bacterial lspA genes, the following methodology would be applicable for cloning and expressing Xcc lspA:

  • Gene Amplification:

    • Design primers based on the Xcc genome sequence to amplify the full-length lspA gene

    • Include appropriate restriction sites for subsequent cloning

    • Use high-fidelity polymerase to minimize mutations

  • Vector Selection:

    • For functional studies: Low to moderate expression vectors with inducible promoters (e.g., pMW119-based systems as used for R. typhi lspA)

    • For structural studies: Vectors with purification tags (His-tag, GST-tag)

  • Expression Host:

    • E. coli is typically used for functional studies of recombinant lspA

    • Common strains include BL21(DE3) for protein production or DH5α for cloning

  • Expression Conditions:

    • Optimize induction conditions (IPTG concentration, temperature, duration)

    • Lower temperatures (16-25°C) often improve the folding of membrane proteins

    • Consider using E. coli strains with rare codon supplementation if Xcc codon usage differs significantly

  • Verification:

    • Confirm sequence integrity through DNA sequencing

    • Verify expression by Western blotting using antibodies against the tag or the lspA protein

    • Conduct functional assays (globomycin resistance, complementation of lspA-deficient strains)

The construction of expression vectors containing lspA can follow similar methods to those used for R. typhi lspA, where the full-length ORF was cloned into a pMW119-derived plasmid for expression in E. coli .

What are the conserved domains and essential residues of bacterial lspA proteins?

Bacterial lipoprotein signal peptidases share several highly conserved domains and residues essential for their catalytic function. Based on studies of lspA homologs, these include:

  • Transmembrane Domains:

    • Typically 4-5 transmembrane segments that anchor the protein in the cytoplasmic membrane

    • The catalytic residues are generally positioned toward the periplasmic side

  • Catalytic Residues:

    • Conserved aspartate residues that form the catalytic dyad essential for peptidase activity

    • These residues coordinate with a water molecule to facilitate peptide bond hydrolysis

  • Substrate Recognition Region:

    • Regions that recognize the lipobox motif (typically L-[A/S/T]-[G/A]-C)

    • Binding pocket that accommodates the diacylglyceryl-modified cysteine

Studies of R. typhi lspA revealed "highly conserved residues and domains that are essential for SPase II activity in lipoprotein processing" . While the specific residues were not detailed in the search results, alignment of Xcc lspA with characterized homologs would likely reveal conservation of these critical functional elements.

What functional assays can verify the activity of recombinant lspA?

Several established assays can determine the functionality of recombinant lspA from Xcc:

  • Globomycin Resistance Assay:

    • Principle: Functional lspA confers resistance to globomycin, a cyclic peptide antibiotic that specifically inhibits SPase II

    • Method: Express recombinant lspA in E. coli and measure growth in increasing concentrations of globomycin (typically 0-200 μg/ml)

    • Expected result: Cells expressing functional lspA show significantly better growth at higher globomycin concentrations compared to controls

  • Genetic Complementation:

    • Principle: Functional lspA can rescue the growth of temperature-sensitive lspA mutant strains

    • Method: Express recombinant Xcc lspA in a temperature-sensitive E. coli strain (e.g., E. coli Y815) and assess growth at non-permissive temperature

    • Expected result: Restoration of growth at the non-permissive temperature indicates functional activity

  • In vitro Processing Assay:

    • Principle: Purified lspA should cleave synthetic or recombinant prolipoprotein substrates

    • Method: Incubate purified lspA with labeled prelipoproteins and analyze cleavage products

    • Expected result: Detection of processed lipoproteins confirms enzymatic activity

  • Mass Spectrometry Analysis:

    • Principle: Functional lspA processing results in specific cleavage products

    • Method: Express a model lipoprotein in systems with and without functional lspA, then analyze by mass spectrometry

    • Expected result: Detection of processed N-termini at the expected cleavage site

These assays provide complementary evidence for lspA functionality, with the globomycin resistance and genetic complementation assays being particularly well-established for initial functional verification .

How can globomycin resistance assays be optimized for studying Xcc lspA function?

Globomycin resistance assays require careful optimization when applied to Xcc lspA:

  • Experimental Design:

    • Express Xcc lspA under control of an inducible promoter (e.g., IPTG-inducible)

    • Include appropriate controls: empty vector (negative), E. coli native lspA (positive)

    • Test multiple expression levels through varying inducer concentrations

  • Globomycin Concentration Range:

    • Initial screening: Broad range (0, 12.5, 25, 50, 100, 200 μg/ml) as used in R. typhi studies

    • Refined analysis: Narrower range around critical inhibitory concentrations

    • Consider constructing full dose-response curves for quantitative analysis

  • Growth Measurement Protocol:

    • Monitor growth kinetics over 24 hours using automated plate readers

    • Record OD600 measurements at regular intervals (e.g., every 30 minutes)

    • Calculate growth rates during exponential phase rather than relying solely on endpoint measurements

  • Statistical Analysis:

    • Compare growth between strains at each globomycin concentration using appropriate statistical tests (e.g., Student's t-test as used in R. typhi studies)

    • Calculate IC50 values (globomycin concentration inhibiting growth by 50%) for quantitative comparison

    • Perform at least three independent biological replicates to ensure reproducibility

  • Validation With Mutational Analysis:

    • Generate site-directed mutants of conserved catalytic residues

    • Test these mutants in parallel to confirm specificity of the resistance phenotype

    • Correlate resistance levels with protein expression levels via Western blotting

The level of globomycin resistance can provide insights into the catalytic efficiency of Xcc lspA compared to homologs from other species. In R. typhi studies, significant resistance was observed at globomycin concentrations of 25-200 μg/ml compared to control cells .

What genetic complementation strategies are most effective for studying lspA function?

Genetic complementation represents a powerful approach for validating lspA function:

  • Heterologous Complementation Systems:

    • Use temperature-sensitive E. coli lspA mutants (e.g., E. coli Y815) that cannot grow at non-permissive temperatures

    • Express Xcc lspA and measure growth restoration at non-permissive temperatures

    • Quantify complementation efficiency compared to positive controls (e.g., native E. coli lspA)

  • Homologous Complementation:

    • Generate Xcc lspA knockout mutants using techniques like allelic exchange

    • Complement with wild-type lspA under native or controlled promoters

    • Assess restoration of lipoprotein processing and virulence phenotypes

  • Conditional Expression Systems:

    • Implement systems where native lspA can be depleted (e.g., CRISPR interference)

    • Express Xcc lspA variants under inducible promoters

    • Measure dose-dependent rescue of growth phenotypes

  • Quantitative Assessment Methods:

    • Measure growth rates under various conditions

    • Assess lipoprotein processing directly through proteomics

    • Evaluate virulence factor secretion and function

  • Controls and Validation:

    • Include vector-only controls

    • Use catalytically inactive mutants as negative controls

    • Verify expression levels of complementing proteins by Western blotting

Studies with R. typhi lspA demonstrated that despite only 22% sequence identity with E. coli lspA, it could partially complement temperature-sensitive E. coli Y815 at non-permissive temperatures. This indicates functional conservation despite sequence divergence . Similar approaches could be applied to Xcc lspA, with quantitative measurement of complementation efficiency providing insights into functional conservation.

How does lspA expression change during different growth phases and infection stages?

Expression dynamics of lspA can provide crucial insights into its physiological role:

  • In vitro Growth Phase Analysis:

    • Monitor lspA, lgt, and lepB expression across growth phases using qRT-PCR

    • Compare expression patterns to understand coordination within the lipoprotein processing pathway

    • Based on R. typhi studies, expect variable expression across growth phases

  • Infection Time Course Studies:

    • Using plant infection models with Xcc, sample tissue at multiple time points

    • Employ qRT-PCR to measure lspA expression relative to housekeeping genes

    • Analyze protein levels using Western blotting if antibodies are available

  • Expression Pattern Interpretation:

    • R. typhi studies showed that lspA and lgt exhibited similar expression patterns, while lepB showed higher expression

    • Early infection stages often show elevated expression of lipoprotein processing genes

    • Expression typically peaks during active replication phases

Based on R. typhi studies, the expression pattern of lipoprotein processing genes shows characteristic changes during growth cycles:

Time PointlspA Expressionlgt ExpressionlepB ExpressionBiological Phase
Pre-infectionHighHighVery HighPreparation for host cell entry
Early post-infection (0-8h)DecreasingDecreasingDecreasing but higher than lspA/lgtInitial adaptation to host environment
Mid-infection (8-48h)IncreasingIncreasingIncreasing, remains higherActive replication phase
Late infection (>120h)DecreasingDecreasingDecreasing, still higherHost cell lysis/bacterial release

This pattern suggests that lipoprotein processing is particularly important during the initial infection phase and during active bacterial replication, with lipoprotein processing genes showing coordinated regulation .

What bioinformatic tools can identify putative lipoproteins processed by Xcc lspA?

Comprehensive lipoprotein prediction requires multiple bioinformatic approaches:

  • Signal Peptide and Lipobox Prediction:

    • SignalP (version 3.0 or newer) - Neural network and hidden Markov model tools for signal peptide prediction

    • LipoP (version 1.0 or newer) - Specifically designed for lipoprotein signal peptide prediction

    • These tools were successfully used to identify putative lipoproteins in R. typhi

  • Consensus-Based Prediction Pipeline:

    • Implement a multi-tool approach combining predictions from:

      • SignalP for general signal peptide detection

      • LipoP for lipoprotein-specific signals

      • PRED-LIPO for transmembrane topology

      • Pattern recognition for lipobox motif (L-[A/S/T]-[G/A]-C)

  • Analysis of Whole Genome Data:

    • Apply prediction tools to the complete Xcc proteome

    • Filter candidates based on consensus predictions and score thresholds

    • Validate top candidates experimentally

  • Comparative Genomic Analysis:

    • Compare predicted lipoproteins across multiple Xanthomonas species

    • Identify conserved lipoproteins that may have core physiological functions

    • Identify Xcc-specific lipoproteins that may relate to host specificity

  • Functional Annotation and Categorization:

    • Categorize predicted lipoproteins by predicted function

    • Identify potential virulence-related lipoproteins

    • Prioritize candidates for experimental validation

In R. typhi, bioinformatic analysis using SignalP 3.0 and LipoP 1.0 identified 89 secretory proteins out of 838 annotated ORFs, with 14 recognized as putative lipoproteins . Similar approaches applied to the Xcc genome would likely reveal comparable proportions of lipoproteins, providing candidates for experimental investigation.

How can transposon mutagenesis approaches be used to study lspA and its substrate lipoproteins in Xcc?

Transposon mutagenesis offers powerful tools for studying lspA function in Xcc:

  • RB-TnSeq Library Construction:

    • Generate a saturated library of randomly barcoded transposon insertion mutants in Xcc, following protocols similar to those used for general Xcc studies

    • Map insertion sites through high-throughput sequencing

    • Identify essential genes, including potential lipoprotein processing components

  • Conditional Lethality Screening:

    • Screen the transposon library under different growth conditions

    • Identify conditions where lspA mutants show growth defects

    • Discover environmental triggers that affect lipoprotein processing requirements

  • In Planta Fitness Assays:

    • Infect host plants with the transposon library

    • Extract bacteria from infected tissues (e.g., hydathodes, xylem)

    • Sequence barcodes to determine relative abundance of each mutant before and after infection

  • Genetic Interaction Mapping:

    • Introduce secondary mutations in lipoprotein processing genes

    • Screen the transposon library in these backgrounds

    • Identify synthetic lethal or suppressor interactions

  • Analysis Methodology:

    • Calculate fitness scores for each mutant based on barcode frequencies

    • Identify genes with significant fitness defects in specific conditions

    • Perform Gene Ontology enrichment analysis to identify functional categories

In the Xcc study using RB-TnSeq, researchers identified 183 genes important for fitness in plant-associated environments . Similar approaches could reveal how lspA and its substrate lipoproteins contribute to Xcc fitness during infection. Competitive index (CI) calculations, as performed for other Xcc genes, could quantify the fitness impact of lspA mutation .

What role does lspA play in Xcc virulence and plant infection?

Understanding the connection between lspA and virulence requires multi-faceted approaches:

  • Construction of lspA Mutants:

    • Generate precise deletions or point mutations in catalytic residues

    • Create conditional expression systems if lspA is essential

    • Verify lipoprotein processing defects in these mutants

  • Plant Infection Assays:

    • Inoculate host plants (e.g., cauliflower) with wild-type and lspA mutant strains

    • Assess infection efficiency, colonization, and symptom development

    • Quantify bacterial populations in plant tissues over time

  • Hydathode Colonization Studies:

    • Since hydathodes are the natural entry site for Xcc , assess colonization efficiency

    • Perform competitive fitness assays between wild-type and lspA mutants

    • Calculate competitive indices to quantify fitness differences

  • Virulence Factor Production:

    • Analyze secretion of known virulence factors in lspA mutants

    • Assess production of extracellular enzymes and toxins

    • Evaluate expression of type III secretion system components

  • Metabolic Fitness in Plant Environments:

    • Test growth in xylem sap and hydathode exudates

    • Assess adaptation to plant-specific nutrients and defense compounds

    • Compare metabolic capabilities of wild-type and lspA mutants

Studies in Xcc revealed that genes involved in metabolism were enriched among fitness determinants in plant-associated environments . If lspA affects the processing of lipoproteins involved in nutrient acquisition or stress responses, its contribution to virulence may be primarily through enabling metabolic adaptation during infection rather than direct virulence factor regulation.

How does Xcc lspA compare structurally and functionally to homologs in other bacterial species?

Comparative analysis provides evolutionary and functional insights:

  • Sequence Homology Analysis:

    • Perform multiple sequence alignments with lspA proteins from diverse bacteria

    • Identify conserved and variable regions

    • Calculate percent identity and similarity scores

  • Structural Prediction and Comparison:

    • Generate structural models using homology modeling or AI-based prediction (AlphaFold)

    • Compare predicted structures to known structures (e.g., from Staphylococcus)

    • Identify potential structural adaptations unique to Xanthomonas

  • Functional Complementation Experiments:

    • Test the ability of Xcc lspA to complement defects in other species

    • Evaluate complementation efficiency compared to sequence similarity

    • R. typhi lspA showed partial complementation of E. coli lspA despite only 22% sequence identity

  • Substrate Specificity Analysis:

    • Compare predicted lipoprotein substrates across species

    • Identify conserved and species-specific substrates

    • Test cross-species processing capabilities

  • Inhibitor Sensitivity Profiles:

    • Compare sensitivity to globomycin and other inhibitors

    • Identify potential species-specific inhibitor interactions

    • Evaluate the correlation between inhibitor binding and sequence conservation

The functional conservation despite sequence divergence observed between R. typhi and E. coli lspA suggests that Xcc lspA likely maintains core functional capabilities while potentially exhibiting species-specific adaptations. These adaptations might relate to the plant pathogenic lifestyle of Xcc, potentially influencing substrate recognition or regulation of enzyme activity.

What are the challenges in purifying active recombinant lspA and how can they be overcome?

Purification of active membrane proteins like lspA presents several challenges:

  • Expression System Optimization:

    • Test multiple expression hosts (E. coli, Pseudomonas, cell-free systems)

    • Evaluate various fusion tags (His, MBP, SUMO) for stability enhancement

    • Optimize induction conditions (temperature, inducer concentration, duration)

  • Membrane Extraction Strategies:

    • Screen detergents for efficient extraction (DDM, LDAO, digitonin)

    • Test native nanodiscs or styrene-maleic acid copolymer lipid particles (SMALPs)

    • Optimize detergent:protein ratios to maintain activity

  • Purification Protocol Development:

    • Implement multi-step purification (affinity, ion exchange, size exclusion)

    • Maintain detergent above critical micelle concentration throughout

    • Consider on-column detergent exchange strategies

  • Activity Preservation Measures:

    • Include lipid supplements (E. coli lipid extract, specific phospholipids)

    • Add stabilizing agents (glycerol, specific salts)

    • Minimize exposure to oxidizing conditions

  • Activity Verification Methods:

    • Develop in vitro assays using fluorescent or radiolabeled substrates

    • Implement mass spectrometry-based activity assays

    • Validate structural integrity through biophysical techniques (CD, thermal shift)

A common workflow would include:

  • Membrane fraction isolation from expression host

  • Solubilization with optimized detergent mixture

  • Immobilized metal affinity chromatography (IMAC)

  • Size exclusion chromatography (SEC)

  • Activity validation using globomycin binding or substrate processing assays

Successful purification would enable detailed enzymological studies, inhibitor screening, and potentially structural determination through X-ray crystallography or cryo-electron microscopy.

What are the key considerations for experimental design when studying Xcc lspA?

Effective experimental design for Xcc lspA research requires attention to several critical factors:

  • Genetic Context:

    • Consider potential essentiality - implement conditional systems if necessary

    • Maintain genomic context for expression studies

    • Account for potential polar effects when creating mutations

  • Physiological Relevance:

    • Design experiments that reflect natural infection conditions

    • Include appropriate plant host systems for virulence studies

    • Consider relevant environmental parameters (pH, temperature, nutrient availability)

  • Methodological Validation:

    • Include appropriate positive and negative controls

    • Validate recombinant systems with functional assays

    • Implement multiple complementary approaches for key findings

  • Comparative Framework:

    • Leverage insights from related bacterial systems

    • Compare results across multiple Xanthomonas species/pathovars

    • Contextualize findings within broader lipoprotein processing pathways

  • Translational Potential:

    • Consider implications for bacterial physiology and pathogenesis

    • Evaluate potential for identifying new antimicrobial targets

    • Assess relevance to agricultural applications

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.