Recombinant Xanthomonas campestris pv. campestris Phosphoglycerol transferase I (opgB)

Shipped with Ice Packs
In Stock

Description

General Information

OpgB, also known as Phosphoglycerol transferase I, is an enzyme that functions as a phosphatidylglycerol--membrane-oligosaccharide glycerophosphotransferase . The protein, with UniProt ID Q8PDD7, has a molecular weight of approximately 79.4 kDa . The full-length recombinant protein consists of 702 amino acids and is fused to an N-terminal His tag when expressed in E. coli .

Table 1: OpgB Information

FeatureDescription
Gene NameopgB
SynonymsopgB; mdoB; XCC0403; Phosphoglycerol transferase I; Phosphatidylglycerol--membrane-oligosaccharide glycerophosphotransferase
SpeciesXanthomonas Campestris pv. Campestris
SourceE. coli
TagHis
Protein LengthFull Length (1-702)
AA SequenceMHWILALSLLLLLLLLVASPRLAWLKAGLLSLLLLLLSAWGLVDRLSGDGVNAATLYHLRADMDGAGVSDFSGYIAVFIGMVLLSLSPLVLLRVRRFRRPRGGGAVFGAFVVMLLVSVAVSPLYRDGKRLYYQLRPVDYATVVPEYQVPQQPLQKRKNIVWIYGESLERTYFDEATFPGLMPNLHQLATEAVDVRNLTSTEGSGWTIAGMVASMCGVPLTTAPGDENSMGRMGLFLPEARCLGDYLKDQGYRNHYVGGADASFAGKGSFLASHGFDVVHDVNYFHDKGVAPKHFSAWGVHDDVLLDDAWDSFQTLSRAGQPFMLTTLTMDTHHPAGHLPLACKNQRYESPLGDIGLLHAIKCSDRLIGRLVTRIRNSRYGRNTIIVIASDHLAMPNDLSDVLAKQKRENLLLFLGKDIPPQQVVTRAGSTLDSGATLLQLLEPGMRTLGFGRSLLANDAPPSASVAASRDSGKNYPRYLAYARTLWTGRSTRMLRVNGNGDVVVGVQQVRPPVLLEYDDNTNLKTVYLENTSRQFDRTHSDGTLAYVDRCTAFEDGSADGDWCALVVDRNQHMKLYRDPDLTRGIAVDAPLDVTPQAPRPRVRQPIMLTQAARKTEAGRYMLELYAKRRPTRAFWVEAVSSERKVVLAQQWVVPDASGRIRMPVGLEHAVEDLEIRAWLDYTEEVSVDDLALVKDTAVADRS
UniProt IDQ8PDD7

Function and Role in Xanthomonas campestris

OpgB is essential for the synthesis of OPGs, which are located in the periplasmic space of Gram-negative bacteria . OPGs play a crucial role in osmotic adaptation and are required for virulence in Xanthomonas campestris . Specifically, Xanthomonas campestris possesses only the malic enzyme-PpsA route in gluconeogenesis, and disruption of ppsA, a key gene in gluconeogenesis, resulted in a significant reduction in virulence .

Biosynthesis of Phosphatidylcholine

Xanthomonas campestris exhibits a unique phosphatidylcholine (PC) biosynthesis pathway that resembles that of yeast . Instead of the typical S-adenosylmethionine (SAM)-dependent phospholipid N-methyltransferases (Pmt) or PC synthase (Pcs) pathways, Xanthomonas adds two acyl side-chains to a glycerophosphocholine (GPC) backbone to produce PC .

Regulation of Type III Secretion System

VemR, a single-domain response regulator in Xanthomonas campestris, modulates the expression of the type III secretion system (T3SS) by interacting with the key regulator HrpG . The T3SS is an essential pathogenicity determinant . VemR modulates about 10% of Xanthomonas campestris genes, which are involved in various cellular processes including the T3SS . VemR physically interacts with proteins such as HpaS and RavA, and the TCS response regulator HrpG, which directly activates the transcription of HrpX, a key regulator controlling T3SS expression .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, but this can be adjusted as needed.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If a specific tag type is required, please inform us, and we will prioritize its development.
Synonyms
opgB; xcc-b100_0434; Phosphoglycerol transferase I; Phosphatidylglycerol--membrane-oligosaccharide glycerophosphotransferase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-702
Protein Length
full length protein
Species
Xanthomonas campestris pv. campestris (strain B100)
Target Names
opgB
Target Protein Sequence
MHWILALSLLLLLWLLVASPRLAWLKAGLLSLLLLLLSAWGLVDRLSGDGINAATLYHLR ADMDGAGVSDFSGYIAVFIGMVLLSLSPLMLLRVRRFRRPRGGGAVFGAFVVMLLVSMAV SPVYRDGKRLYYQLRPVDYATVVPEYQVPQQPLQKRKNIVWIYGESLERTYFDEATFPGL MPNLRQLATEAVDVRNLTSTEGSGWTIAGMVASMCGVPLTTAPGDENSMGRMGLFLPEAR CLGDYLKDQGYRNHYVGGADASFAGKGSFLASHGFDVVHDVNYFHDKGVAPKHFSAWGVH DDVLLDDAWESFQTLSRAGQPFMLTTLTMDTHHPAGHLPLACKNQRYESPLGDIGLLHAI KCSDRLIGELVTRIRNSRYGRNTIIVIASDHLAMPNDLSDVLAKQKRENLLLFLGKDIPP QQVVRRAGSTLDSGATLLQLLEPGMRTLGFGRSLLANDAPPSASVAASRDSGRDYPRYLA YARTLWTGRSTRMLRVNGNGDVVVGVQQVRPPVLLEYDDDTNLKTVYLENTSRQFDRTHS DGTLAYVDRCTAFEDGSADGDWCALVVDRNQHMKLYRDPDLTRGIAVDAPLDVTPQAPRP RVRQPIMLTQAARKTEAGRYMLELYAKRRPTRAFWVEAVSSERKVVLAQQWVVPDASGRI RMPVGLEHAVEDLGIRAWLDYTEEVSVDDLALVKDTAVADRS
Uniprot No.

Target Background

Function

This protein transfers a phosphoglycerol residue from phosphatidylglycerol to the membrane-bound nascent glucan backbones.

Database Links
Protein Families
OpgB family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the biological function of Phosphoglycerol Transferase I (opgB) in Xanthomonas campestris pv. campestris?

Phosphoglycerol transferase I, encoded by the opgB gene in Xanthomonas campestris pv. campestris (Xcc), is an essential enzyme involved in the biosynthesis of osmoregulated periplasmic glucans (OPGs). The enzyme functions by transferring phosphoglycerol residues from membrane phosphatidylglycerol to nascent OPG molecules . OPGs are crucial for bacterial adaptation to environmental conditions, particularly during osmotic stress, and contribute significantly to bacterial virulence in plant hosts. The phosphoglycerol modification of OPGs alters their physical properties, influencing bacterial membrane characteristics and potentially affecting pathogen-host interactions .

Unlike similar genes in other bacterial species, the opgB gene in Xcc encodes both membrane-bound (enzyme I) and soluble periplasmic (enzyme II) forms of phosphoglycerol transferase, demonstrating a unique dual functionality not observed in all bacterial pathogens . This distinctive characteristic makes the opgB gene particularly interesting for pathogenicity studies in Xcc.

How do osmoregulated periplasmic glucans contribute to Xanthomonas campestris pv. campestris pathogenicity?

Osmoregulated periplasmic glucans (OPGs) play a critical role in Xanthomonas campestris pv. campestris (Xcc) pathogenicity through multiple mechanisms:

  • Osmotic adaptation: OPGs help Xcc adapt to the varying osmotic conditions encountered during plant infection, allowing bacterial survival in different plant tissue environments.

  • Virulence factor regulation: OPGs influence the production and secretion of various virulence factors, including extracellular polysaccharides (EPS) which are critical for Xcc pathogenicity .

  • Host-pathogen interaction: Phosphoglycerol-substituted OPGs may interact with plant cell receptors, potentially suppressing host defense responses.

  • Bacterial fitness: Mutations affecting OPG synthesis or modification result in reduced bacterial fitness and attenuated virulence, similar to what has been observed with opgH mutations in related pathovars .

Research has shown that bacteria with impaired OPG production or modification exhibit significantly reduced virulence in plant infection models. For instance, studies on related pathovars demonstrated that mutation in the opgH gene (functionally related to opgB) resulted in reduced aggressiveness and attenuated growth in planta . The addition of mannitol at low concentrations (25-50 mM) to modify osmotic potential in plant intercellular spaces can partially compensate for these mutations, further supporting the osmotic adaptation role of OPGs .

How does Phosphoglycerol Transferase I differ from other transferases involved in OPG modification?

TransferaseGeneLocationSubstrateTiming of ActionTarget
Phosphoglycerol Transferase IopgBMembrane-boundMembrane phosphatidylglycerolProgressive processNascent OPG molecules
Phosphoglycerol Transferase IIopgB (same gene)Periplasmic (soluble)OPG-bound phosphoglycerolAfter initial substitutionExchanges between OPG molecules
Phosphoethanolamine TransferaseopgEMembranePhosphoethanolamineNot fully characterizedOPG molecules
Succinyl TransferaseUnknownUnknownSuccinyl-CoA (presumed)Rapid (during backbone polymerization)OPG backbone

Phosphoglycerol transferase I, encoded by opgB, differs from other OPG-modifying enzymes in several key aspects. Unlike phosphoethanolamine transferase (encoded by opgE), which transfers phosphoethanolamine residues, phosphoglycerol transferase I specifically transfers phosphoglycerol groups .

The timing of action also distinguishes these enzymes. Research has shown that phosphoglycerol addition by transferase I is a very progressive process, whereas succinyl residue addition occurs rapidly, likely during backbone polymerization . This temporal difference suggests distinct regulatory mechanisms and biological roles for different OPG modifications.

Uniquely, both phosphoglycerol transferase I (membrane-bound) and phosphoglycerol transferase II (periplasmic) are encoded by the same opgB gene in Escherichia coli, and similar organization is believed to exist in Xanthomonas . This dual functionality from a single gene represents an efficient use of genetic material and suggests evolutionary importance of phosphoglycerol modification in bacterial adaptation.

What are the optimal protocols for cloning and expressing recombinant Xanthomonas campestris pv. campestris opgB?

Successfully cloning and expressing Xanthomonas campestris pv. campestris (Xcc) opgB requires careful consideration of multiple factors. Based on successful protocols used in similar studies, the following methodological approach is recommended:

Cloning Strategy:

  • Gene isolation: PCR amplification of the opgB gene from Xcc genomic DNA using high-fidelity polymerase. Design primers with appropriate restriction sites compatible with your expression vector. Include the native promoter if studying regulation, or use inducible promoters for controlled expression .

  • Vector selection: For laboratory-scale expression, pET-based vectors work effectively for E. coli expression systems. For complementation studies in Xcc, broad-host-range vectors such as pBBR1MCS derivatives are recommended .

  • Host selection: E. coli BL21(DE3) is suitable for protein expression, while E. coli DH5α is preferred for cloning. For complementation studies, use opgB-deficient Xcc strains .

Expression Protocol:

  • Induction conditions for E. coli: When using IPTG-inducible systems, induce at OD600 of 0.6-0.8 with 0.1-0.5 mM IPTG. Optimal expression typically occurs at 28°C for 4-6 hours to minimize inclusion body formation.

  • Membrane protein considerations: As phosphoglycerol transferase I is membrane-associated, expression should be optimized to avoid toxicity. Lower induction temperatures (16-18°C) and reduced inducer concentrations may improve proper membrane insertion.

  • Verification methods: Confirm expression using Western blotting with anti-His tag antibodies (if using His-tagged constructs). Functional verification can be performed by complementation of opgB mutants and analyzing OPG phosphoglycerol content.

Purification Approach:

  • Membrane fraction isolation: Use differential centrifugation to isolate membrane fractions containing the membrane-bound enzyme.

  • Detergent solubilization: Optimize detergent type and concentration (typically 1% n-dodecyl-β-D-maltoside or 0.5% Triton X-100) for enzyme extraction while maintaining activity.

  • Affinity chromatography: If using tagged constructs, purify using appropriate affinity resins (Ni-NTA for His-tagged proteins).

Following NIH Guidelines for Research Involving Recombinant DNA Molecules is essential, with appropriate biosafety measures based on the risk assessment (typically BSL-2 for Xcc) .

How should researchers establish and validate opgB knockout mutants in Xanthomonas campestris pv. campestris?

Creating and validating opgB knockout mutants in Xanthomonas campestris pv. campestris (Xcc) requires a systematic approach to ensure proper gene inactivation while minimizing polar effects on adjacent genes. The following methodological framework is recommended:

Mutant Construction Methods:

  • Homologous recombination approach:

    • Construct a suicide vector containing 500-1000 bp homologous regions flanking the opgB gene

    • Insert an antibiotic resistance cassette (e.g., kanamycin or gentamicin) between the flanking regions

    • Transfer the construct into Xcc via electroporation or triparental mating

    • Select for single crossover integrants on antibiotic-containing media

    • Counter-select for double crossover events using sucrose sensitivity (if using sacB-based vectors)

  • Tn5 insertion mutagenesis (alternative approach):

    • Generate a library of Tn5 insertion mutants in Xcc

    • Screen for reduced virulence phenotypes similar to those observed in related opgH mutants

    • Confirm insertion location using Southern blot analysis to verify single Tn5 insertion in the opgB region

Validation Methods:

  • Genetic verification:

    • PCR confirmation using primers flanking the deletion/insertion site

    • Southern blot analysis to confirm gene disruption and single insertion

    • Whole genome sequencing to rule out secondary mutations (for critical experiments)

  • Transcriptional verification:

    • RT-PCR or qRT-PCR to confirm absence of opgB transcript

    • RNA-seq to assess potential polar effects on adjacent genes

  • Biochemical verification:

    • Analysis of OPG phosphoglycerol content using thin-layer chromatography or mass spectrometry

    • Expected result: Significant reduction in phosphoglycerol substitution of OPGs

  • Functional validation:

    • Osmotic sensitivity assays (growth curves in media of varying osmolarities)

    • Virulence assays on susceptible host plants (e.g., cabbage 'Wirosa')

    • Complementation with wild-type opgB to restore phenotype

Phenotypic Characterization Framework:

ParameterWild-type XccopgB MutantComplemented MutantMethodology
Growth in standard mediaNormalNormal or slightly reducedRestored to WTGrowth curves (OD600)
Osmotic stress toleranceGrowth in low osmolarityReduced growth in low osmolarityRestored to WTGrowth at varying NaCl/sucrose concentrations
OPG phosphoglycerol contentHighLow or absentRestored to WTMass spectrometry analysis
Virulence on host plantsFull virulenceReduced virulenceRestored to WTPlant inoculation and disease rating
Epiphytic survivalExtended survivalReduced survivalRestored to WTRecovery of bacteria from leaf surface over time

The successful construction and validation of opgB mutants provides a valuable tool for understanding the role of phosphoglycerol transferase I in Xcc pathogenicity and osmoadaptation .

What biosafety considerations apply when working with recombinant Xanthomonas campestris pv. campestris?

Working with recombinant Xanthomonas campestris pv. campestris (Xcc) requires adherence to established biosafety guidelines to protect researchers, the environment, and prevent accidental release of modified plant pathogens. The following comprehensive biosafety framework should be implemented:

Risk Assessment and Classification:

  • Containment Level Determination:

    • Laboratory work: Biosafety Level 1 (BSL-1) containment is generally sufficient for basic laboratory manipulations

    • Plant inoculations: BSL-2 plant (BL2-P) containment is required when working with viable cultures and plant inoculations

  • Institutional Requirements:

    • All recombinant DNA research must be registered with and approved by the Institutional Biosafety Committee (IBC) prior to initiation

    • Principal Investigators must complete the appropriate IBC registration forms detailing:

      • The nature of the genetic modifications

      • Containment measures to be employed

      • Risk mitigation strategies

Laboratory Practices and Procedures:

  • Engineering Controls:

    • Work should be conducted in designated laboratory areas with restricted access

    • Use of biological safety cabinets for procedures that may generate aerosols

    • Separate storage areas for cultures and recombinant constructs

  • Personal Protective Equipment:

    • Laboratory coats dedicated to the work area

    • Gloves when handling cultures or potentially contaminated materials

    • Eye protection when splashes are possible

  • Waste Management:

    • All materials contacting Xcc must be decontaminated before disposal

    • Autoclave all solid waste at 121°C for 30 minutes

    • Liquid cultures should be treated with 10% bleach (final concentration) for a minimum of 30 minutes

  • Spill Response Protocol:

    • Cover spills with paper towels

    • Apply appropriate disinfectant (10% bleach) working from the perimeter inward

    • Allow 20-30 minutes contact time before cleanup

    • Document and report according to institutional policies

Special Considerations for Plant Pathogen Work:

  • Greenhouse Containment:

    • Use of dedicated greenhouse spaces with appropriate signage

    • Control of water runoff to prevent environmental release

    • Insect control measures to prevent vector-mediated spread

    • Autoclave all plant material after experiments

  • Transport Regulations:

    • Secure, leak-proof containers with appropriate biohazard labeling

    • Triple containment for transport between facilities

    • Compliance with USDA/APHIS permits if applicable

  • Experiment-Specific Precautions:

    • Conduct pathogenicity assays in contained environments only

    • Implement measures to prevent cross-contamination between wild-type and recombinant strains

    • Maintain detailed records of all manipulations and storage locations

All personnel working with recombinant Xcc must receive appropriate training in biosafety procedures, good microbiological practices, and emergency response protocols prior to beginning work . The Principal Investigator bears primary responsibility for ensuring compliance with these biosafety requirements.

How does the crystal structure of Phosphoglycerol Transferase I inform functional analyses and inhibitor design?

While the complete crystal structure of Phosphoglycerol Transferase I (opgB) from Xanthomonas campestris pv. campestris has not been fully determined, structural insights can be inferred from homologous proteins and computational modeling. This structural understanding provides critical information for functional analyses and potential inhibitor design strategies.

Predicted Structural Features:

Based on sequence homology with related transferases, Phosphoglycerol Transferase I likely contains:

  • Membrane-spanning domains: Multiple transmembrane helices that anchor the protein to the bacterial inner membrane, positioning the active site to access both cytoplasmic and periplasmic compartments.

  • Catalytic domain: A conserved region containing the active site responsible for phosphoglycerol transfer from phosphatidylglycerol to OPG molecules.

  • Substrate binding pockets: Specific regions that recognize and bind phosphatidylglycerol and nascent OPG molecules, determining substrate specificity.

Structure-Function Relationships:

Understanding structure-function relationships is critical for advanced research applications:

  • Catalytic mechanism: The spatial arrangement of catalytic residues likely facilitates a direct transfer mechanism similar to that observed in other glycosyltransferases, where both donor (phosphatidylglycerol) and acceptor (OPG) must be positioned precisely for reaction.

  • Membrane association: The membrane-bound nature of Phosphoglycerol Transferase I suggests a mechanism where the enzyme can access phospholipids directly from the membrane while simultaneously interacting with periplasmic OPGs.

  • Dual functionality: The unique ability of opgB to encode both membrane-bound and soluble forms suggests a protein structure capable of alternative processing or post-translational modification .

Implications for Inhibitor Design:

The structural features of Phosphoglycerol Transferase I present several opportunities for rational inhibitor design:

  • Active site targeting: Compounds that mimic the transition state of the phosphoglycerol transfer reaction could serve as competitive inhibitors.

  • Allosteric inhibition: Molecules binding to regulatory sites could induce conformational changes that prevent substrate binding or catalysis.

  • Membrane interface disruption: Compounds that interfere with the protein-membrane interaction could potentially disrupt enzyme function without directly targeting the active site.

  • Protein-protein interaction inhibitors: If Phosphoglycerol Transferase I functions as part of a larger complex, disrupting these interactions could impair function.

Mutational Analysis Strategy:

DomainTarget ResiduesExpected EffectValidation Method
Catalytic siteConserved acidic residues (predicted)Loss of enzymatic activityPhosphoglycerol transferase assay
Membrane-spanningHydrophobic to charged substitutionsDisrupted membrane localizationCellular fractionation, immunolocalization
Substrate bindingConserved polar residuesAltered substrate specificityBinding assays, altered kinetics
Interface regionSurface-exposed residuesDisrupted protein interactionsCo-immunoprecipitation

Advanced structural studies using techniques such as cryo-electron microscopy or X-ray crystallography would significantly enhance our understanding of opgB structure and function, potentially revealing novel targets for antimicrobial development against Xanthomonas campestris pv. campestris and related plant pathogens .

How can systems biology approaches enhance our understanding of opgB in Xcc pathogenicity networks?

Systems biology approaches offer powerful frameworks for elucidating the complex role of opgB within the broader pathogenicity networks of Xanthomonas campestris pv. campestris (Xcc). These multidisciplinary methods provide insights beyond traditional reductionist approaches, revealing the integrated function of opgB in bacterial virulence.

Genome-Scale Metabolic Modeling:

The development of comprehensive metabolic models for Xcc, such as the model constructed for Xcc B100 strain, provides a foundation for understanding the metabolic context of opgB function:

  • Network integration: Placing phosphoglycerol transferase I within the 437 biochemical reactions and 338 internal metabolites of the reconstructed Xcc metabolic network reveals interconnections with primary metabolism .

  • Flux balance analysis: In silico simulations can predict the impact of opgB mutation on central carbon metabolism and biomass production, similar to analyses performed with xanthan-deficient mutants .

  • Resource allocation modeling: Computational models can investigate how opgB activity influences the distribution of resources between pathogenicity factors (like OPGs) and essential cellular processes, potentially explaining observed phenotypes.

Multi-Omics Integration:

Combining multiple omics datasets provides a comprehensive view of opgB's role in Xcc:

  • Transcriptomics: RNA-seq analysis comparing wild-type and opgB mutants under various environmental conditions (osmotic stress, plant extract exposure) reveals co-regulated gene networks and potential regulatory connections.

  • Proteomics: Quantitative proteomics identifies changes in protein abundance and post-translational modifications affected by opgB mutation, particularly in membrane proteins and secreted virulence factors.

  • Metabolomics: Profiling of periplasmic and membrane lipid composition reveals how altered phosphoglycerol transferase activity affects bacterial metabolic state and membrane properties.

  • Interactomics: Protein-protein interaction studies identify opgB's binding partners, potentially revealing functional complexes involved in OPG biosynthesis and modification.

Network Analysis Framework:

Data TypeAnalysis MethodExpected InsightsIntegration Point
TranscriptomeDifferential expression, co-expression networksRegulatory connections, stress response pathwaysGene regulatory networks
ProteomeAbundance changes, interaction mappingProtein complexes, post-translational regulationFunctional modules
MetabolomeFlux analysis, metabolite profilingResource allocation, membrane composition changesMetabolic pathways
PhenomeHigh-throughput phenotyping, virulence assaysFitness landscapes, host-specificity determinantsPhenotype-genotype maps

Implementation Strategy:

  • Data generation: Perform multi-omics analyses on isogenic wild-type and opgB mutant strains under standardized conditions (varying osmolarity, plant extracts, in planta).

  • Computational integration: Utilize machine learning approaches to identify patterns across datasets that correlate with virulence phenotypes.

  • Network visualization: Construct comprehensive pathogenicity networks highlighting opgB's connections to other virulence factors, such as the pigB-regulated extracellular polysaccharide production .

  • Model validation: Test predictions through targeted experiments, such as double-knockout studies of opgB with predicted interaction partners.

A systems biology approach has already yielded valuable insights for Xcc, as demonstrated by the metabolic model validation showing resource redistribution from xanthan to biomass in gumD mutants . Similar approaches applied to opgB would likely reveal its systemic role in Xcc pathogenicity networks, potentially identifying novel intervention targets for controlling black rot disease in cruciferous crops .

What are the molecular mechanisms of opgB regulation in response to environmental stimuli?

The regulation of opgB expression and activity in Xanthomonas campestris pv. campestris (Xcc) involves sophisticated molecular mechanisms that respond to environmental cues, particularly osmotic conditions. Although specific details about opgB regulation in Xcc are still being elucidated, research on related systems provides valuable insights into probable regulatory mechanisms.

Transcriptional Regulation:

Multiple levels of transcriptional control likely govern opgB expression in response to environmental stimuli:

  • Osmoresponsive promoter elements: The opgB promoter region likely contains regulatory elements responsive to osmotic changes. Low osmolarity environments typically induce expression of OPG biosynthesis genes, including opgB, through specific transcription factors.

  • Two-component regulatory systems: Signal transduction pathways involving sensor kinases and response regulators likely mediate environmental sensing and transcriptional responses. These systems detect changes in membrane tension or periplasmic solute concentration and modulate opgB expression accordingly.

  • Global regulators: Evidence from related systems suggests that global regulators of bacterial physiology, such as RpoS (stationary phase sigma factor) and CRP (catabolite repressor protein), may influence opgB expression as part of broader stress responses.

Post-Transcriptional Control:

Several mechanisms likely fine-tune opgB expression after transcription:

  • mRNA stability regulation: Environmental conditions may affect the stability of opgB transcripts through RNA-binding proteins or small regulatory RNAs that respond to osmotic stress.

  • Translational efficiency: Ribosome binding site accessibility or secondary structures in the opgB mRNA might be modulated by environmental factors, affecting translation initiation rates.

Post-Translational Regulation:

Phosphoglycerol transferase I activity appears to be regulated at the protein level:

  • Enzyme activation: Evidence from related systems suggests that enzyme activity may be directly modulated by osmotic conditions, potentially through conformational changes induced by altered membrane properties or ion concentrations.

  • Substrate availability: The activity of phosphoglycerol transferase I is inherently linked to phosphatidylglycerol availability in the membrane, which can be affected by environmental conditions and growth phase.

  • Protein processing: The dual functionality of opgB encoding both membrane-bound and periplasmic forms suggests a regulated processing mechanism that may respond to environmental cues .

Regulatory Networks and Environmental Stimuli:

Environmental StimulusExpected Regulatory ResponseMolecular MechanismFunctional Outcome
Low osmolarityIncreased opgB expressionOsmoresponsive promoter activationEnhanced OPG production for osmoadaptation
Membrane stressAltered enzyme activityConformational changes in membrane-bound enzymeModified OPG phosphoglycerol content
Plant-derived signalsIntegration with virulence regulonsCross-talk with pathogenicity regulatory networksCoordinated virulence factor production
Nutrient limitationResource allocation shiftsGlobal regulatory networks (stringent response)Balanced investment in OPGs vs. growth

Experimental Approaches for Studying opgB Regulation:

  • Promoter fusion studies: Constructing opgB promoter-reporter gene fusions to monitor transcriptional responses to environmental stimuli.

  • Chromatin immunoprecipitation (ChIP): Identifying transcription factors that bind the opgB promoter under different environmental conditions.

  • Ribosome profiling: Measuring translational efficiency of opgB mRNA under varying osmotic conditions.

  • Activity assays: Directly measuring phosphoglycerol transferase activity in membrane preparations from cells grown under different environmental conditions.

Understanding the molecular mechanisms of opgB regulation would provide insights into how Xcc coordinates OPG modification with other aspects of bacterial physiology and virulence. This knowledge could potentially reveal vulnerable points in the regulatory network that could be targeted for disease control strategies .

Why might recombinant Xcc opgB protein show different activity levels in vitro versus in vivo?

Discrepancies between in vitro and in vivo activity of recombinant Xanthomonas campestris pv. campestris (Xcc) phosphoglycerol transferase I (opgB) are common challenges in enzyme characterization. These differences can arise from multiple factors related to the experimental systems and biological contexts:

Membrane Environment Differences:

  • Lipid composition: The native Xcc membrane contains specific phospholipids and lipopolysaccharides that may be essential for optimal enzyme activity. In vitro systems using artificial membranes or detergent micelles may lack these specific components .

  • Membrane fluidity and curvature: The physical properties of membranes in living cells differ from reconstructed in vitro systems, potentially affecting enzyme conformation and activity.

  • Lipid microdomains: Functional membrane microdomains in vivo may concentrate substrates or provide specific local environments that are absent in purified systems.

Protein Modifications and Interactions:

  • Post-translational modifications: In vivo, phosphoglycerol transferase I may undergo modifications (phosphorylation, proteolytic processing) that affect activity but are absent in recombinant systems.

  • Protein-protein interactions: The enzyme may function as part of a larger complex in vivo, with interaction partners that enhance activity or substrate channeling. Evidence from related systems suggests that OPG biosynthesis enzymes may form functional complexes .

  • Conformation stability: The native conformation maintained in the cellular environment may be difficult to preserve during purification and in vitro assays.

Substrate Availability and Presentation:

  • Substrate access: In vivo, the enzyme has simultaneous access to membrane phospholipids and nascent OPG molecules, while in vitro systems may present these substrates differently.

  • Substrate concentration: Local substrate concentrations at membrane interfaces in vivo may differ significantly from those used in standard in vitro assays.

Experimental Approaches to Reconcile Differences:

FactorDiagnostic TestPotential Solution
Membrane compositionActivity assays with varied lipid compositionsReconstitute enzyme in liposomes with Xcc lipid extract
Protein conformationCircular dichroism spectroscopy comparing native vs. recombinant proteinOptimize purification conditions to maintain native structure
Interaction partnersPull-down assays to identify binding partnersCo-express identified interaction partners
Post-translational modificationsMass spectrometry analysis of native proteinSite-directed mutagenesis to mimic modifications
Substrate presentationVaried substrate delivery methodsDevelop assay systems that better mimic cellular interfaces

Interpretation Guidelines:

When confronted with activity differences between in vitro and in vivo systems, researchers should:

  • Consider complementation studies: Assess whether recombinant opgB can restore wild-type phenotypes when expressed in opgB mutants, which provides functional validation despite biochemical differences .

  • Develop improved assay systems: Membrane-mimetic systems such as nanodiscs or native membrane vesicles may better represent the in vivo environment.

  • Integrate multiple activity measures: Combine direct enzymatic assays with analyses of OPG phosphoglycerol content and related phenotypes to build a comprehensive picture of enzyme function.

  • Account for temporal aspects: The progressive nature of phosphoglycerol addition observed in vivo may be difficult to capture in standard in vitro assays with fixed timepoints .

Understanding these differences is crucial for accurate interpretation of experimental results and development of targeted strategies to modulate phosphoglycerol transferase I activity for research or applied purposes.

How can researchers troubleshoot unsuccessful complementation of opgB mutants?

Unsuccessful complementation of Xanthomonas campestris pv. campestris (Xcc) opgB mutants can occur for multiple reasons, creating challenges in functional validation experiments. A systematic troubleshooting approach can help identify and resolve these issues:

Expression Vector and Construct Design Issues:

  • Promoter strength and compatibility: Inappropriate promoter choice may lead to expression levels that are too low or too high for proper function.

    • Solution: Test multiple promoters (native, constitutive, and inducible) to optimize expression levels.

  • Incomplete gene sequence: Missing regulatory elements or incomplete coding sequences can result in non-functional protein.

    • Solution: Include the complete opgB gene with sufficient upstream and downstream regions to capture all regulatory elements.

  • Fusion tags interference: N-terminal or C-terminal tags may interfere with protein folding, membrane insertion, or activity.

    • Solution: Test constructs with removable tags or no tags; if tags are necessary, vary their position and include flexible linkers.

Expression and Localization Problems:

  • Insufficient expression: Low protein levels may be insufficient for complementation.

    • Diagnostic: Perform Western blot analysis to confirm expression.

    • Solution: Optimize codon usage for Xcc, use stronger ribosome binding sites, or stabilize mRNA.

  • Improper localization: Phosphoglycerol transferase I must be correctly inserted into the membrane for function.

    • Diagnostic: Perform cellular fractionation to verify membrane localization.

    • Solution: Ensure signal sequences or membrane-targeting domains are intact.

  • Protein instability: Rapid degradation of the recombinant protein can prevent functional complementation.

    • Diagnostic: Monitor protein stability over time using pulse-chase experiments.

    • Solution: Identify and modify protease recognition sites or co-express with chaperones.

Functional and Genetic Background Considerations:

  • Polar effects on adjacent genes: The original mutation may affect genes beyond opgB.

    • Diagnostic: Perform RT-PCR to analyze expression of adjacent genes.

    • Solution: Include adjacent genes in the complementation construct if necessary.

  • Suppressor mutations: The mutant strain may have accumulated additional mutations that interfere with complementation.

    • Solution: Generate fresh mutants or sequence the genome of the mutant strain to identify secondary mutations.

  • Stoichiometric imbalance: Phosphoglycerol transferase I may function in a complex requiring precise stoichiometry.

    • Solution: Co-express potential interaction partners or use vectors that ensure appropriate expression levels.

Systematic Troubleshooting Approach:

IssueDiagnostic TestPotential SolutionsExpected Outcome if Resolved
Expression levelWestern blot, RT-qPCROptimize promoter, RBS, codon usageDetectable protein at levels similar to wild-type
Protein localizationMembrane fractionationVerify signal sequences, membrane targetingProtein detected in membrane fraction
Protein functionalityIn vitro activity assayModify construct design, remove interfering elementsRestored enzymatic activity
OPG modificationOPG extraction and analysisOptimize expression conditionsRestored phosphoglycerol content of OPGs
Genetic backgroundWhole genome sequencingCreate new mutant, complement in different backgroundSuccessful complementation in alternative background
Phenotypic assay sensitivityWild-type controls, positive controlsRefine assay conditions, use quantitative measuresClear distinction between complemented and mutant phenotypes

Alternative Complementation Strategies:

  • Genomic integration: Rather than plasmid-based expression, integrate the wild-type opgB gene back into the chromosome at its native locus or at a neutral site.

  • Heterologous complementation: Test whether opgB homologs from related species can complement the Xcc mutant, which may provide insights into functional conservation and critical domains.

  • Domain complementation: Express specific domains of phosphoglycerol transferase I to determine which regions are essential for function and potentially identify interaction interfaces.

Successful complementation is crucial for confirming gene function and ensuring phenotypic observations are directly attributable to opgB mutation rather than secondary effects . The systematic approach outlined above provides a comprehensive framework for troubleshooting complementation failures in Xcc opgB mutants.

What strategies can resolve contradictory data between different phosphoglycerol transferase activity assays?

Contradictory results from different phosphoglycerol transferase activity assays present significant challenges for researchers studying Xanthomonas campestris pv. campestris (Xcc) opgB. Resolving these discrepancies requires a systematic approach to identify sources of variation and establish standardized, reliable assay methods.

Sources of Assay Variability:

  • Enzyme source heterogeneity: Differences in enzyme preparation methods can significantly impact activity measurements.

    • Membrane preparations may retain or lose critical lipid components depending on isolation method

    • Detergent-solubilized enzyme may show altered substrate specificity or activity

    • Recombinant protein expression systems may introduce artifacts

  • Substrate presentation differences: The physical state of substrates critically affects enzyme accessibility and activity.

    • Phosphatidylglycerol presented in micelles, liposomes, or native membranes can yield different activity profiles

    • OPG substrates may require specific presentations for optimal enzyme recognition

  • Detection method sensitivity: Various methods for measuring phosphoglycerol transfer have different sensitivity and specificity profiles.

    • Radioactive assays offer high sensitivity but potential safety concerns

    • Colorimetric assays may suffer from interference by assay components

    • Mass spectrometry-based methods offer specificity but may be less quantitative

Standardization and Resolution Framework:

Contradiction TypeUnderlying CauseResolution StrategyValidation Approach
Activity detected in one assay but not anotherDetection threshold differencesImplement more sensitive detection methodsCross-validate with multiple detection techniques
Different relative activities between mutantsAssay-specific artifactsStandardize enzyme preparation and assay conditionsCompare rank-order across multiple assay formats
Inconsistent kinetic parametersSubstrate presentation differencesDevelop assays that mimic native membrane environmentCompare parameters with in vivo phenotypes
Conflicting inhibitor effectivenessAssay-specific binding interferenceTest inhibitors in multiple assay formatsValidate with cellular and in planta studies

Methodological Reconciliation Approaches:

  • Comprehensive assay comparison study:

    • Systematically test the same enzyme preparations across multiple assay formats

    • Identify factors that cause variability (pH, ionic strength, detergents, lipid composition)

    • Establish correction factors to normalize results between assays

  • Development of a standardized reference assay:

    • Create a detailed protocol with stringent quality control measures

    • Include standard enzyme preparations as internal controls

    • Establish acceptance criteria based on control performance

  • Multi-method validation approach:

    • Integrate results from complementary methods:

      • Direct enzyme activity measurements

      • OPG composition analysis

      • Membrane phospholipid turnover

      • Functional complementation

    • Weight evidence based on method reliability and relevance to in vivo function

Decision-Making Algorithm for Data Reconciliation:

  • Evaluate methodological rigor: Assess each assay for appropriate controls, replication, and statistical analysis.

  • Consider biological relevance: Prioritize assays that most closely mimic the cellular environment where phosphoglycerol transferase I functions.

  • Assess consistency with phenotypic data: Methods yielding results that better correlate with in vivo phenotypes should receive greater weight.

  • Implement triangulation approach: When possible, use at least three different methods to measure the same parameter, looking for convergence of results.

  • Develop predictive models: Create mathematical models that account for assay-specific variables to reconcile seemingly contradictory results.

By implementing these strategies, researchers can resolve contradictions between different phosphoglycerol transferase activity assays and establish a more reliable foundation for understanding the biochemical functions of the opgB gene product in Xcc . This systematic approach not only resolves immediate conflicts in the data but also contributes to establishing standardized methods for the broader research community.

How might targeted modifications of opgB enable the development of attenuated Xcc strains for agricultural applications?

The strategic modification of the opgB gene in Xanthomonas campestris pv. campestris (Xcc) presents promising opportunities for developing attenuated strains with agricultural applications. These engineered strains could serve as biocontrol agents, vaccine strains for plant protection, or research tools with minimal environmental risk.

Rational Design Strategies for Attenuated Xcc Strains:

  • Conditional attenuation approaches:

    • Develop opgB variants under environmentally-responsive promoters that are inactive under field conditions but active in laboratory settings

    • Create temperature-sensitive opgB mutants that function normally at laboratory temperatures but are attenuated at field temperatures

  • Domain-specific modifications:

    • Engineer targeted mutations in catalytic domains to create strains with reduced but not eliminated phosphoglycerol transferase activity

    • Modify substrate recognition domains to alter OPG modification patterns, resulting in strains with predictable levels of attenuation

  • Regulatory circuit engineering:

    • Develop synthetic regulatory systems controlling opgB expression that respond to specific chemical inducers

    • Create genetic circuits linking opgB function to plant defense recognition, causing self-attenuation upon plant detection

Potential Agricultural Applications:

ApplicationAttenuation StrategyMechanism of ActionExpected Benefits
Cross-protection agentsPartial opgB functionLimited colonization without disease, triggering plant immunityNatural disease protection without yield impact
Vaccine delivery vehiclesEngineered opgB for transient survivalDelivery of selected antigens to plant immune systemTargeted immunity against virulent strains
Biological control vectorsopgB variants with host-specific attenuationCompetitive exclusion of virulent strains in ecological nicheReduced chemical pesticide usage
Agricultural probioticsEngineered strains with beneficial traits but attenuated virulencePromotion of plant growth while preventing diseaseEnhanced crop yield with disease protection

Experimental Validation Framework:

  • Laboratory assessment phase:

    • Create opgB variant library using site-directed mutagenesis or domain shuffling

    • Screen for strains with desired attenuation profiles in controlled conditions

    • Characterize OPG modification patterns and membrane properties

  • Controlled environment testing:

    • Evaluate colonization ability and persistence in plant systems

    • Assess competitive fitness against wild-type strains

    • Measure protective effects against virulent challenge strains

  • Biosafety assessment:

    • Determine genetic stability of attenuated phenotypes

    • Evaluate potential for horizontal gene transfer

    • Assess environmental persistence and spread potential

  • Field trial considerations:

    • Design containment strategies compliant with NIH Guidelines for Recombinant DNA Research

    • Implement monitoring systems for tracking engineered strains

    • Establish protocols for biological containment if necessary

Potential Challenges and Solutions:

  • Phenotypic instability: Attenuated strains may revert to virulence through compensatory mutations.

    • Solution: Implement multiple attenuating modifications and genetic safeguards.

  • Unexpected ecological impacts: Engineered strains may interact with the environment in unpredicted ways.

    • Solution: Conduct comprehensive ecological studies with progressive release strategies.

  • Regulatory hurdles: Approval processes for engineered microorganisms in agriculture are complex.

    • Solution: Design strains that comply with existing regulatory frameworks for reduced-risk biopesticides.

  • Public acceptance: Genetically modified microorganisms may face public skepticism.

    • Solution: Develop transparent communication strategies focusing on reduced chemical inputs and sustainability benefits.

The development of attenuated Xcc strains through opgB modification represents a promising approach for creating next-generation agricultural tools that balance efficacy with environmental safety . Such innovations could contribute significantly to sustainable crop protection strategies, particularly for cruciferous vegetables affected by black rot disease.

What novel screening methods could identify specific inhibitors of Phosphoglycerol Transferase I for potential disease management?

Developing specific inhibitors of Phosphoglycerol Transferase I (encoded by opgB) in Xanthomonas campestris pv. campestris (Xcc) represents a promising approach for controlling black rot disease in cruciferous crops. Novel screening methods that combine high-throughput capabilities with selective targeting can accelerate the discovery of potential disease management compounds.

Advanced Screening Platforms:

  • High-throughput biochemical assays:

    • Fluorescence-based transfer assays: Develop fluorescently labeled phosphatidylglycerol analogs that change spectral properties upon transfer to OPG acceptors.

    • Bioluminescence resonance energy transfer (BRET): Engineer donor-acceptor pairs to monitor enzyme-substrate interactions in real-time.

    • Surface plasmon resonance (SPR): Screen compounds for direct binding to recombinant phosphoglycerol transferase I.

  • Cell-based screening platforms:

    • Reporter strain systems: Engineer Xcc strains with opgB promoter-reporter fusions to identify compounds affecting expression levels.

    • Growth inhibition arrays: Screen compounds in osmotic challenge conditions where opgB function becomes essential for bacterial survival.

    • Whole-cell activity monitoring: Develop assays to measure OPG phosphoglycerol content following compound treatment.

  • Advanced computational approaches:

    • Structure-based virtual screening: Utilize homology models or experimental structures of phosphoglycerol transferase I to screen virtual compound libraries.

    • Molecular dynamics simulations: Identify allosteric sites and conformational changes that could be targeted by small molecules.

    • Machine learning algorithms: Train predictive models on preliminary screening data to prioritize compounds for detailed testing.

Innovative Screening Methodologies:

Screening ApproachTechnical ImplementationAdvantagesConsiderations
Fragment-based screeningNMR-based detection of small molecule binding to target enzymeIdentifies building blocks for highly specific inhibitorsRequires purified, stable enzyme preparations
Phenotypic screens in plant systemsCompound application to infected plants with disease progression monitoringIncorporates bioavailability and in planta efficacyMay identify compounds with alternative modes of action
Natural product librariesScreening extracts from plants, microbes, and marine organismsAccess to diverse chemical scaffolds with potential specificityDeconvolution of active components can be challenging
Targeted DNA-encoded librariesChemical libraries linked to DNA barcodes for pooled screeningUltra-high throughput with structure-activity relationship dataRequires sophisticated synthesis and sequencing infrastructure

Selectivity and Specificity Considerations:

  • Counter-screening strategy:

    • Test candidate inhibitors against homologous enzymes from beneficial bacteria

    • Evaluate effects on plant phospholipid metabolism to avoid phytotoxicity

    • Assess impact on human gut microbiota enzymes for food safety considerations

  • Selectivity optimization approaches:

    • Structure-activity relationship studies focusing on Xcc-specific binding pockets

    • Development of prodrugs activated by Xcc-specific enzymes

    • Design of compounds targeting unique interfaces in enzyme-substrate interactions

Validation and Development Pipeline:

  • Primary hit validation:

    • Confirm target engagement using thermal shift assays or enzyme activity measurements

    • Evaluate broad-spectrum activity against diverse Xcc isolates

    • Assess resistance development potential through passage experiments

  • Lead optimization strategy:

    • Medicinal chemistry refinement for enhanced potency and selectivity

    • Formulation development for agricultural application

    • Stability testing under field-relevant conditions

  • In planta efficacy testing:

    • Greenhouse trials on multiple cruciferous crop species

    • Disease prevention and curative application timing studies

    • Integration with existing disease management approaches

The development of specific phosphoglycerol transferase I inhibitors offers several advantages over traditional broad-spectrum antimicrobials:

  • Reduced impact on beneficial microorganisms in the plant microbiome

  • Potentially lower environmental impact through targeted activity

  • Novel mode of action to address antimicrobial resistance concerns

  • Specific targeting of a validated virulence mechanism in Xcc

By implementing these novel screening methods, researchers can accelerate the discovery of phosphoglycerol transferase I inhibitors with potential to become effective, environmentally responsible tools for managing black rot disease in cruciferous crops.

How might CRISPR-Cas technologies facilitate advanced functional studies of opgB in Xanthomonas campestris pv. campestris?

CRISPR-Cas technologies offer unprecedented precision for genetic manipulation, providing powerful new approaches for studying the opgB gene in Xanthomonas campestris pv. campestris (Xcc). These revolutionary tools can address longstanding challenges in bacterial functional genomics and enable sophisticated experiments previously difficult or impossible to perform.

Genome Editing Applications:

  • Precise gene modifications:

    • Scarless mutations: Create precise point mutations, deletions, or insertions in opgB without leaving selection markers or scars.

    • Domain-specific alterations: Target specific functional domains of phosphoglycerol transferase I to dissect structure-function relationships.

    • Regulatory element engineering: Modify promoters, operators, and other regulatory elements to study opgB expression control.

  • Multiplex genome editing:

    • Simultaneously modify opgB and related genes (e.g., other OPG biosynthesis components) to study genetic interactions.

    • Create combinatorial mutation libraries to identify synthetic phenotypes.

    • Engineer strains with mutations in multiple pathways to understand the broader context of opgB function.

  • Chromosomal integration applications:

    • Precise integration of reporter constructs at the native opgB locus for physiologically relevant expression studies.

    • Creation of tagged versions of phosphoglycerol transferase I at its native location.

    • Integration of modified opgB variants for complementation without plasmid maintenance concerns.

CRISPR Interference (CRISPRi) and Activation (CRISPRa) Applications:

  • Tunable gene expression:

    • Develop inducible CRISPRi systems to achieve controlled, partial repression of opgB.

    • Create gradients of opgB expression to identify thresholds for various phenotypes.

    • Apply dynamic control of opgB expression during infection processes.

  • Temporal expression studies:

    • Repress opgB at specific timepoints during plant colonization to determine stage-specific requirements.

    • Implement pulse-repression experiments to study the kinetics of OPG turnover.

    • Create synthetic gene circuits for programmed expression patterns.

  • Spatially restricted manipulation:

    • Couple CRISPRi to environmentally responsive promoters for condition-specific repression.

    • Develop systems that respond to plant-derived signals to study in planta regulation.

Advanced Functional Genomics Applications:

CRISPR TechnologyExperimental ApplicationExpected InsightsTechnical Advantages
Base editingIntroduction of precise SNPsStructure-function relationships of specific residuesAvoids double-strand breaks and homology-directed repair
Prime editingComplex edits with precisionEngineering specific substrate recognition motifsGreater editing flexibility without donor templates
CRISPR-Cas12/13RNA targeting and visualizationopgB transcript dynamics and localizationStudy post-transcriptional regulation without genomic modification
CRISPR droplet sequencingHigh-throughput phenotypingSystematic functional map of opgB domainsMassively parallel mutation analysis

Innovative Experimental Designs Enabled by CRISPR:

  • Saturation mutagenesis libraries:

    • Create comprehensive collections of single amino acid substitutions across phosphoglycerol transferase I.

    • Screen for mutations affecting enzyme activity, substrate specificity, or membrane localization.

    • Identify residues essential for in planta function versus laboratory growth.

  • Synthetic biology applications:

    • Engineer orthogonal phosphoglycerol transferase variants with altered substrate specificity.

    • Create synthetic regulatory circuits controlling opgB in response to defined signals.

    • Develop biosensor strains that report on phosphoglycerol transferase activity.

  • In situ studies:

    • Combine CRISPR-based genome editing with advanced imaging to track enzyme localization.

    • Study protein-protein interactions in native contexts through proximity labeling.

    • Investigate dynamics of OPG modification during osmotic transitions.

Implementation Considerations:

  • Delivery methods optimization:

    • Develop efficient transformation protocols for CRISPR components into Xcc.

    • Optimize Cas9/Cas12 expression for activity in Xanthomonas.

    • Consider phage-based delivery systems for difficult-to-transform strains.

  • Off-target effect management:

    • Employ high-fidelity Cas variants to minimize unintended editing.

    • Perform whole-genome sequencing to verify the specificity of edits.

    • Use computational prediction tools to design highly specific gRNAs.

  • Regulatory and biosafety considerations:

    • Address containment requirements for engineered strains according to NIH Guidelines.

    • Consider potential ecological implications of enhanced genetic manipulation.

    • Develop built-in safeguards for experimental strains .

CRISPR-Cas technologies represent a transformative toolkit for studying opgB function in Xcc, enabling unprecedented precision in genetic manipulation and functional analysis. These approaches promise to accelerate our understanding of phosphoglycerol transferase I biology and potentially lead to novel strategies for controlling black rot disease in cruciferous crops .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.