Recombinant Xanthomonas campestris pv. campestris Potassium-transporting ATPase C chain (kdpC)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice is specifically requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline for your use.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
kdpC; xcc-b100_3651; Potassium-transporting ATPase KdpC subunit; ATP phosphohydrolase [potassium-transporting] C chain; Potassium-binding and translocating subunit C; Potassium-translocating ATPase C chain
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-209
Protein Length
full length protein
Species
Xanthomonas campestris pv. campestris (strain B100)
Target Names
kdpC
Target Protein Sequence
MSTSLPLRDDGAVRASFALALFVLLGLGLGYSLVATGITSALMPDQAHGSLLRADGRVIG SSLVAQPFADARYFQPRPSAAKYDPTAAAGSNQARSNPELLARIATARAEIAQRDGIAPD AVPGELLTQSGSGLDPHLSPAGAQVQLRRVAAARGWPEQRVAALLQAATEQPQFGLLGQP RINVLALNLALDRAGDGVPGTENGVEQQR
Uniprot No.

Target Background

Function
This protein is a component of the high-affinity ATP-driven potassium transport (Kdp) system. It catalyzes ATP hydrolysis coupled with the electrogenic transport of potassium ions into the cytoplasm. Specifically, this subunit functions as a catalytic chaperone, enhancing the ATP-binding affinity of the ATP-hydrolyzing subunit KdpB through the formation of a transient KdpB/KdpC/ATP ternary complex.
Database Links
Protein Families
KdpC family
Subcellular Location
Cell inner membrane; Single-pass membrane protein.

Q&A

What is the biological function of the Potassium-transporting ATPase C chain (kdpC) in Xanthomonas campestris pv. campestris?

The Potassium-transporting ATPase C chain (kdpC) is a crucial component of the KdpFABC complex, which functions as a high-affinity potassium uptake system in bacteria. In Xanthomonas campestris pv. campestris, this complex plays a vital role in potassium homeostasis, particularly under limited potassium conditions. The KdpC subunit specifically contributes to the stability and regulatory functions of the complex, interacting with the catalytic KdpB subunit. The complex demonstrates potassium:proton antiporter activity and is involved in potassium ion transmembrane transport through ATP hydrolysis . This system is particularly important for Xcc survival in plant environments where potassium availability may fluctuate.

How does the structure of kdpC in Xanthomonas campestris compare to homologous proteins in other bacterial species?

While the specific structure of kdpC in Xanthomonas campestris has not been fully characterized in the provided search results, structural insights can be drawn from homologous proteins. The KdpFABC complex has been studied using cryo-electron microscopy in Escherichia coli, revealing important structural features of the E2 inward-facing state .

The KdpC chain is part of the P-type ATPase superfamily of K+ transporters. Structural analysis reveals that KdpC contributes to the stability of the complex and participates in conformational changes during the transport cycle. Cross-species comparison indicates conserved domains responsible for potassium ion binding, transmembrane transport, and interaction with other subunits of the complex . Further research is needed to determine Xcc-specific structural features that might differ from the E. coli model.

What are the recommended methods for expressing and purifying recombinant kdpC from Xanthomonas campestris?

For successful expression and purification of recombinant kdpC from Xanthomonas campestris, the following methodological approach is recommended:

  • Cloning Strategy: The kdpC gene should be amplified from Xcc genomic DNA using specific primers designed based on the annotated genome sequence. The PCR product can be inserted into an appropriate expression vector containing a histidine or other affinity tag for purification.

  • Expression System: For membrane proteins like kdpC, expression in specialized systems such as E. coli C41(DE3) or C43(DE3) strains is recommended to minimize toxicity and protein aggregation. Alternatively, yeast expression systems have been successfully used for recombinant Xcc proteins .

  • Culture Conditions: Cultivation should be performed at 30°C in appropriate media. Based on protocols for other Xcc proteins, growth in synthetic media with defined components is recommended, similar to the XMD minimal media (containing 30 g/L glucose and appropriate nitrogen sources) used for Xcc cultivation .

  • Protein Extraction and Purification: Cell disruption can be achieved using methods similar to those applied for proteome analysis of Xcc, such as treatment with 2,2,2-trifluoroethanol (TFE) and dithiothreitol (DTT) at 60°C for 60 minutes . For membrane proteins like kdpC, detergent solubilization is typically required, followed by affinity chromatography and size exclusion chromatography for purification.

  • Quality Control: Verification of protein identity and purity can be performed using mass spectrometry and SDS-PAGE, with functional assays to confirm activity.

How does potassium availability affect the expression and activity of kdpC in Xanthomonas campestris during plant infection?

The expression and activity of kdpC in Xanthomonas campestris is likely regulated by environmental potassium levels, particularly during plant infection. Though specific data for kdpC regulation is not directly provided in the search results, insights can be drawn from related research on Xcc adaptation mechanisms.

Xanthomonas campestris is known to modulate gene expression in response to environmental conditions during plant infection. The pathogen undergoes distinct growth phases when cultivated in controlled environments, with specific growth rates of 0.13 h⁻¹ ± 0.00062 h⁻¹ between 6 and 24 h, and 0.05 h⁻¹ ± 0.0036 h⁻¹ between 24 h and 42 h, before reaching stationary phase . These growth phases correlate with changes in nutrient availability and likely involve differential expression of transport systems.

For investigating kdpC regulation specifically, researchers should consider the following methodological approach:

  • Transcriptome Analysis: Compare kdpC expression levels in Xcc grown under varying potassium concentrations, ranging from limiting to excess.

  • Reporter Constructs: Develop promoter-reporter fusions to monitor kdpC expression in real-time during different growth phases and infection stages.

  • Knockout Studies: Create kdpC deletion mutants and evaluate their ability to survive in potassium-limited environments and infect host plants.

  • In planta Expression: Use RT-qPCR or RNA-seq to quantify kdpC expression during different stages of plant infection, correlating expression with potassium levels in plant tissues.

The results would likely demonstrate upregulation of kdpC under potassium-limited conditions, particularly during the initial colonization stages of plant infection when the pathogen must compete with the host for essential nutrients.

What is the role of kdpC in Xanthomonas campestris virulence and adaptation to host environments?

The kdpC subunit, as part of the KdpFABC complex, likely contributes significantly to Xanthomonas campestris virulence through enabling adaptation to varying potassium concentrations in host plants. Although direct evidence for kdpC's role in virulence is not explicitly stated in the search results, several lines of evidence suggest its importance:

Xanthomonas campestris pathogenicity depends on its ability to acquire nutrients from the host. The bacterium converts carbon to glucose through gluconeogenesis, which is essential for virulence . Similarly, potassium acquisition systems like KdpFABC would be crucial for maintaining cellular homeostasis during infection.

When investigating the role of kdpC in virulence, researchers should implement the following experimental design:

  • Mutant Analysis: Generate kdpC knockout or point-mutation variants and compare their virulence to wild-type Xcc in standardized plant infection assays.

  • Complementation Studies: Restore kdpC function in mutants to confirm phenotype specificity.

  • Localization Analysis: Determine the subcellular localization of KdpC during different infection stages using fluorescent protein fusions or immunolocalization.

  • Interaction Studies: Identify host factors that may interact with the KdpFABC complex using pull-down assays or yeast two-hybrid screens.

Xcc has evolved specialized infection mechanisms, including type III secretion systems (TTSS) that transfer effector proteins to lower host defenses . Understanding how kdpC activity coordinates with these virulence systems would provide insights into the pathogen's adaptive strategies.

How can structural analysis of kdpC contribute to the development of novel antimicrobial strategies against Xanthomonas campestris?

Structural analysis of kdpC from Xanthomonas campestris could significantly advance the development of targeted antimicrobial strategies by identifying unique features that could be exploited for pathogen-specific inhibition. While the provided search results don't include specific structural data for Xcc kdpC, the approach can be informed by related structural studies of the KdpFABC complex.

The E. coli KdpFABC complex has been studied using cryo-EM to determine its conformation in the E2 inward-facing state . Similar methodologies could be applied to the Xcc complex, focusing on the following strategies:

  • Comparative Structural Analysis: Compare the kdpC structure from Xcc with homologs from other bacteria, particularly non-pathogenic species, to identify unique structural features.

  • Potential Binding Site Identification: Examine the interface between kdpC and other subunits of the complex to identify potential sites for small molecule inhibitors that could disrupt complex formation or function.

  • Molecular Dynamics Simulations: Model the conformational changes of kdpC during the transport cycle to identify transient states that might be vulnerable to inhibition.

  • Structure-Based Drug Design: Use the structural information to design inhibitors that specifically target Xcc kdpC without affecting human transporters or beneficial microbiota.

The development of such targeted antimicrobials could provide alternatives to current control measures for Xcc infections, which typically rely on copper fungicides applied to healthy plants to prevent bacterial spread .

What are the optimal conditions for cultivating Xanthomonas campestris for kdpC expression studies?

For optimal cultivation of Xanthomonas campestris in kdpC expression studies, researchers should consider the following protocol based on established methods for Xcc cultivation:

Growth Media and Conditions:

  • Pre-culture: TY-medium (5 g/L tryptone, 3 g/L yeast extract, 0.7 g/L CaCl₂) overnight at 30°C with shaking at 180 rpm .

  • Main culture: XMD minimal media containing 30 g/L glucose and appropriate nitrogen sources (such as 6 g/L ammonium nitrate) .

  • Culture vessels: 2 L Erlenmeyer flasks with a culture volume of 200 mL for laboratory-scale studies .

  • Temperature: 30°C, which aligns with the optimal temperature range (25-30°C) for Xcc growth .

  • Agitation: 180 rpm in a laboratory shaker .

  • Initial OD₆₀₀: 0.1 when inoculating from pre-culture .

Growth Phases and Monitoring:
The growth of Xanthomonas campestris typically follows a pattern of:

  • Lag phase (approximately 6 hours)

  • First logarithmic growth phase (6-24 hours, specific growth rate: 0.13 h⁻¹ ± 0.00062 h⁻¹)

  • Second logarithmic growth phase (24-42 hours, specific growth rate: 0.05 h⁻¹ ± 0.0036 h⁻¹)

  • Stationary phase (after 42 hours)

Regular monitoring of optical density at 600 nm is recommended to track growth progression. For kdpC expression studies specifically, sampling at different growth phases would be important to understand expression patterns.

Environmental Factors to Consider:

  • Carbon to nitrogen ratio: High C/N ratios may influence expression patterns .

  • Potassium availability: For kdpC studies specifically, controlling potassium concentrations is crucial.

  • pH: Should be monitored and maintained in the appropriate range for Xcc growth.

This cultivation protocol provides a foundation for reliable and reproducible kdpC expression studies in Xanthomonas campestris.

What molecular detection methods can be used to specifically identify and quantify kdpC expression in Xanthomonas campestris?

Several molecular detection methods can be employed to specifically identify and quantify kdpC expression in Xanthomonas campestris:

PCR-Based Methods:

  • Conventional PCR: Design specific primers targeting the kdpC gene region in Xcc. Similar to the SCAR markers developed for detection of Xcc race 6 , specific primers can be designed for kdpC amplification.

  • Quantitative Real-Time PCR (qPCR): For quantification of kdpC gene expression, qPCR using SYBR Green or TaqMan probes provides sensitive detection. Reference genes for normalization should be carefully selected based on their stability under the experimental conditions.

  • Reverse Transcription PCR (RT-PCR): For analyzing kdpC mRNA expression, total RNA extraction followed by RT-PCR can be performed. This provides insights into transcriptional regulation.

Protein Detection Methods:

  • Western Blotting: Using specific antibodies against KdpC for detection and semi-quantitative analysis of protein levels.

  • Mass Spectrometry: Label-free quantification methods can be employed similar to those used in proteome profiling of Xcc. The MaxQuant software (version 1.6.14.0 or newer) can be used for analysis with the following parameters:

    • Methionine oxidation and N-terminal acetylation as variable modifications

    • Cysteine carbamidomethylation as fixed modification

    • Trypsin as digestion enzyme with maximum 2 missed cleavages

    • Label-free quantification enabled

    • Unique peptides used for quantification

    • Random decoy mode for FDR calculation

Reporter Systems:

  • Fluorescent Protein Fusions: Creating translational fusions of kdpC with fluorescent proteins like GFP to visualize expression patterns.

  • Luciferase Reporter Assays: Fusing the kdpC promoter to luciferase genes for quantitative analysis of promoter activity.

Sample Preparation Protocol:
For protein extraction and preparation for mass spectrometry analysis:

  • Resuspend cell pellets in 100 μL of 100 mM ammonium bicarbonate

  • Add 100 μL of 2,2,2-trifluoroethanol (TFE) and 5 μL of 200 mM dithiothreitol (DTT)

  • Incubate at 60°C for 60 minutes for cell disruption

  • Process samples according to standard protocols for tryptic digestion and mass spectrometry analysis

These methods provide complementary approaches to comprehensively analyze kdpC expression at both the transcriptional and translational levels in Xanthomonas campestris.

What are the recommended approaches for studying the interaction between kdpC and other subunits of the KdpFABC complex in Xanthomonas campestris?

The study of interactions between kdpC and other subunits of the KdpFABC complex in Xanthomonas campestris requires a multi-faceted approach combining structural, biochemical, and genetic methods:

Structural Analysis Techniques:

Biochemical Interaction Assays:

  • Co-Immunoprecipitation (Co-IP): Using antibodies against kdpC to pull down the entire complex and identify interacting partners.

  • Cross-linking Mass Spectrometry: Chemical cross-linking followed by mass spectrometry analysis can identify interacting regions between subunits. The protocol for protein extraction and mass spectrometry used in Xcc proteome analysis can be adapted:

    • Resuspend purified complex in appropriate buffer

    • Apply chemical cross-linkers at optimized concentrations

    • Digest with trypsin

    • Analyze by mass spectrometry using MaxQuant with parameters for cross-linked peptide identification

  • Surface Plasmon Resonance (SPR): For measuring binding kinetics between purified kdpC and other subunits.

  • Isothermal Titration Calorimetry (ITC): To quantify the thermodynamics of binding interactions.

Genetic and In Vivo Approaches:

  • Bacterial Two-Hybrid Assays: Adapted for membrane proteins to detect direct interactions between kdpC and other subunits.

  • Site-Directed Mutagenesis: Creating point mutations in potential interaction domains followed by functional assays to assess the impact on complex formation and activity.

  • Fluorescence Resonance Energy Transfer (FRET): Using fluorescent protein fusions to study the proximity and interaction of subunits in living cells.

  • Complementation Assays: In kdpC knockout strains, expression of mutant variants can reveal domains critical for interaction with other subunits.

Computational Approaches:

  • Molecular Docking: Predicting interaction interfaces between kdpC and other subunits.

  • Molecular Dynamics Simulations: Studying the dynamic behavior of the complex in a simulated membrane environment.

  • Coevolution Analysis: Identifying co-evolving residues between subunits that likely form interaction interfaces.

By combining these complementary approaches, researchers can develop a comprehensive understanding of how kdpC interacts with other subunits of the KdpFABC complex in Xanthomonas campestris, providing insights into the functional dynamics of this important potassium transport system.

How should researchers interpret discrepancies in kdpC functional data between different Xanthomonas campestris strains?

When interpreting discrepancies in kdpC functional data between different Xanthomonas campestris strains, researchers should consider multiple factors that may contribute to the observed variations:

Genetic Diversity and Strain Specificity:
Xanthomonas campestris exhibits significant genetic diversity, with numerous pathovars and races that show distinct pathogenicity patterns . Whole genome alignment studies have revealed genetic differences between Xcc races, strains, and pathovars . These genetic variations may extend to the kdpC gene and its regulatory elements, potentially resulting in functional differences between strains.

Methodological Framework for Reconciling Discrepancies:

  • Comparative Genomic Analysis: Sequence the kdpC gene and its regulatory regions across multiple strains to identify strain-specific polymorphisms. Align these sequences to identify conserved and variable regions that might explain functional differences.

  • Expression Level Analysis: Quantify kdpC expression levels across different strains under identical conditions using qRT-PCR or proteomics approaches. Methods similar to those used in Xcc proteome analysis can be employed:

    • Grow strains under identical conditions

    • Extract proteins using standardized protocols

    • Analyze by mass spectrometry with appropriate normalization

    • Compare expression levels to identify strain-specific patterns

  • Functional Complementation: Exchange kdpC alleles between strains showing functional differences to determine if the gene itself or the genetic background contributes to the observed discrepancies.

  • Environmental Response Profiling: Test multiple strains under varying potassium concentrations and environmental conditions to create a response profile for each strain, which may reveal strain-specific adaptation mechanisms.

Data Interpretation Framework:
When analyzing discrepancies, consider the following hierarchical approach:

  • Confirm that the discrepancies are reproducible and not due to experimental variation.

  • Determine if the discrepancies correlate with known genetic differences between strains.

  • Assess whether environmental or experimental conditions might differentially affect kdpC function in different strains.

  • Consider evolutionary pressures that might have driven functional divergence in kdpC between strains adapted to different ecological niches.

By systematically addressing these factors, researchers can develop a more comprehensive understanding of the true biological significance of observed discrepancies in kdpC function across Xanthomonas campestris strains.

What statistical approaches are recommended for analyzing kdpC expression data in relation to potassium transport efficiency in Xanthomonas campestris?

For analyzing the relationship between kdpC expression and potassium transport efficiency in Xanthomonas campestris, the following statistical approaches are recommended:

Experimental Design Considerations:

  • Replication: Include at least four biological replicates for robust statistical analysis, similar to the approach used in Xcc proteome profiling studies .

  • Time-course Analysis: Sample at multiple time points during growth to capture dynamic expression patterns, such as the six time points used in the Xcc proteome study .

  • Control Conditions: Include appropriate controls, such as wild-type strains and defined potassium concentrations.

Statistical Analysis Methods:

  • Correlation Analysis:

    • Pearson or Spearman correlation coefficients can be calculated between kdpC expression levels and potassium transport rates

    • Example table format for correlation analysis:

    StrainK⁺ Concentration (mM)kdpC Expression (Relative Units)K⁺ Transport Rate (nmol/min/mg)Correlation Coefficient (r)p-value
    Xcc B1000.18.2 ± 0.642.5 ± 3.10.87<0.001
    Xcc B1001.04.5 ± 0.428.7 ± 2.40.81<0.001
    Xcc B10010.01.3 ± 0.212.3 ± 1.60.75<0.005
  • Regression Analysis:

    • Linear or non-linear regression models can establish the mathematical relationship between expression and transport

    • Multiple regression can incorporate additional variables (e.g., growth phase, pH)

    • Consider using mixed-effects models to account for repeated measurements and random effects

  • Analysis of Variance (ANOVA):

    • One-way or two-way ANOVA can test for significant differences in kdpC expression across different experimental conditions

    • Post-hoc tests (e.g., Tukey's HSD) can identify specific significant differences between conditions

  • Principal Component Analysis (PCA):

    • PCA can identify patterns in multivariate data (e.g., expression of multiple genes in the kdp operon)

    • This approach was successfully used in proteome analysis of Xcc

  • Time-Series Analysis:

    • For expression data collected over time, methods such as autocorrelation, cross-correlation, and dynamic time warping can identify temporal patterns and delays between expression and functional response

Data Normalization and Processing:

  • For proteomics data, employ normalization approaches similar to those used in the Xcc proteome study: classic mode normalization with minimal peptide ratio count of 2 and unique peptides for quantification .

  • For expression data, normalize to appropriate reference genes that show stable expression under varying potassium conditions.

  • For transport rate measurements, normalize to total protein content or cell number to account for differences in growth.

Visualization Approaches:

  • Scatter plots with regression lines to visualize correlation between expression and transport

  • Heat maps to display expression patterns across multiple conditions

  • Box plots to show distribution of data and identify outliers

  • Time-course plots to visualize dynamic changes in expression and transport

By applying these statistical approaches, researchers can rigorously analyze the relationship between kdpC expression and potassium transport efficiency in Xanthomonas campestris, enabling the identification of significant patterns and correlations that provide insights into the functional role of kdpC in potassium homeostasis.

What emerging technologies could advance our understanding of kdpC function in Xanthomonas campestris?

Several emerging technologies hold promise for advancing our understanding of kdpC function in Xanthomonas campestris:

Advanced Structural Biology Techniques:

  • Cryo-Electron Tomography: This technique could enable visualization of the KdpFABC complex in its native cellular environment, providing insights into in situ organization and interactions with other cellular components.

  • Single-Particle Analysis with Improved Resolution: Advances in cryo-EM technology continue to improve resolution, potentially allowing more detailed structural analysis of the KdpFABC complex than the current studies on E. coli homologs .

  • Time-Resolved Structural Methods: These approaches could capture transient conformational states during the transport cycle, providing dynamic structural information.

Genomic and Gene Editing Technologies:

  • CRISPR-Cas9 Genome Editing: Precise modification of the kdpC gene in Xanthomonas campestris could enable detailed structure-function studies. Modifications could include:

    • Point mutations in key functional residues

    • Domain swapping with homologs from other species

    • Introduction of tags for in vivo tracking without disrupting function

  • Single-Cell Genomics and Transcriptomics: These technologies could reveal cell-to-cell variability in kdpC expression and function within Xcc populations during plant infection.

Advanced Imaging and In Vivo Analysis:

  • Super-Resolution Microscopy: Techniques such as PALM, STORM, or STED could provide nanoscale resolution of KdpC localization and dynamics in living cells.

  • Biosensors for Potassium Transport: Development of genetically encoded fluorescent biosensors for real-time monitoring of potassium transport in living Xcc cells could directly correlate kdpC activity with potassium flux.

  • Correlative Light and Electron Microscopy (CLEM): This approach could combine functional imaging with structural analysis in the same cells.

Systems Biology Approaches:

  • Multi-omics Integration: Combining transcriptomics, proteomics, metabolomics, and fluxomics data could provide a comprehensive view of how kdpC functions within the broader cellular network.

  • Network Analysis: Constructing protein-protein interaction networks centered on kdpC could reveal unexpected functional connections.

  • Machine Learning for Predictive Modeling: Training algorithms on multi-omics datasets could predict how kdpC function responds to various environmental perturbations.

In Planta Technologies:

  • In Planta Imaging: Advanced microscopy techniques for visualizing bacterial proteins during plant infection could track kdpC activity during pathogenesis.

  • Plant-Microbe Interface Analysis: New methods for studying the chemical and physical environment at the plant-microbe interface could provide insights into the conditions that regulate kdpC expression and function during infection.

These emerging technologies have the potential to significantly advance our understanding of kdpC function in Xanthomonas campestris, particularly in the context of its role in potassium homeostasis and pathogenicity.

What are the most promising directions for developing targeted inhibitors of kdpC function in Xanthomonas campestris?

The development of targeted inhibitors against kdpC function in Xanthomonas campestris represents a promising approach for controlling this important plant pathogen. Based on current knowledge and techniques, the following research directions show particular promise:

Structure-Based Drug Design Approaches:

  • Identification of Unique Structural Features: Comparative analysis of kdpC structures between Xanthomonas and beneficial or non-pathogenic bacteria could reveal unique structural features that can be targeted specifically. This approach would minimize off-target effects on beneficial microbiota.

  • Targeting Protein-Protein Interaction Interfaces: The interfaces between kdpC and other subunits of the KdpFABC complex represent potential targets for inhibitors. These interfaces can be identified through structural studies similar to those conducted on the E. coli KdpFABC complex .

  • Allosteric Inhibitor Design: Identifying allosteric sites that could modulate kdpC function upon inhibitor binding. These sites are often less conserved than active sites, potentially offering greater specificity.

Potential Target Sites and Inhibitor Classes:

Target Site TypeRationalePotential Inhibitor ClassesDevelopment Approach
ATP binding pocketDisrupts energy couplingATP analogs, small moleculesStructure-based virtual screening
Potassium binding siteBlocks substrate transportIon mimetics, chelatorsFragment-based drug design
Subunit interfacesDisrupts complex assemblyPeptide mimetics, stapled peptidesProtein-protein interaction disruptors
Conformational change sitesLocks protein in inactive stateSmall molecules, nanobodiesMolecular dynamics simulation-guided design

High-Throughput Screening Strategies:

  • Phenotypic Screening: Testing compound libraries against Xcc growth under potassium-limited conditions where kdpC function is essential.

  • Target-Based Screening: Using purified kdpC or reconstituted KdpFABC complex to screen for direct binding or inhibition of function.

  • Fragment-Based Screening: Identifying low molecular weight compounds that bind to kdpC and can be elaborated into more potent inhibitors.

Innovative Delivery Approaches:

  • Plant-Incorporated Protectants: Engineering crop plants to produce inhibitors of bacterial kdpC function.

  • Nanoparticle Delivery Systems: Developing nanoparticles that can selectively deliver inhibitors to bacterial cells while protecting compounds from environmental degradation.

  • Biological Control Integration: Combining kdpC inhibitors with biological control agents for synergistic effects.

Resistance Management Strategies:

  • Multi-Target Approaches: Developing inhibitors that simultaneously target multiple components of potassium transport systems.

  • Cycling and Combination Strategies: Designing protocols for alternating or combining different classes of inhibitors to minimize resistance development.

  • Evolutionary Constraints Analysis: Identifying functionally critical residues in kdpC that are under evolutionary constraint, as mutations in these residues might lead to significant fitness costs.

By pursuing these research directions, scientists can work toward developing effective inhibitors of kdpC function in Xanthomonas campestris, potentially leading to new control strategies for this significant plant pathogen that causes substantial crop losses worldwide .

How can understanding kdpC function in Xanthomonas campestris contribute to improved control strategies for black rot disease?

Understanding the function of kdpC in Xanthomonas campestris can significantly contribute to developing improved control strategies for black rot disease through several pathways:

Fundamental Contributions to Plant Disease Management:

The Potassium-transporting ATPase C chain (kdpC) plays a crucial role in bacterial potassium homeostasis, which is essential for pathogen survival and virulence. By elucidating the mechanisms of kdpC function, researchers can develop targeted approaches that interfere with the pathogen's ability to maintain ionic balance during infection, potentially reducing its virulence and survival in plant tissues.

Practical Applications in Disease Control:

  • Molecular Diagnostics Development: Understanding kdpC sequence and expression patterns can enable the development of molecular detection methods similar to the PCR-based markers that have been developed for Xcc race 6 . These could provide early, specific detection of Xanthomonas campestris in field settings, allowing for targeted intervention before widespread infection occurs.

  • Resistant Crop Development: Knowledge of how kdpC functions during plant infection could inform breeding programs or genetic engineering approaches to develop crops with resistance mechanisms specifically targeting this bacterial function. Plants could be engineered to express inhibitors of kdpC function or to create an ionic environment in the apoplast that challenges the pathogen's potassium acquisition systems.

  • Biological Control Strategies: Understanding the environmental conditions that regulate kdpC expression could lead to the development of biocontrol agents or cultural practices that create unfavorable conditions for kdpC function, thereby reducing pathogen fitness without chemical interventions.

  • Integrated Management Approaches: Knowledge of kdpC function can be incorporated into integrated pest management strategies that combine multiple control methods based on an understanding of pathogen biology. For example, timing applications of control measures to coincide with periods of high kdpC expression or activity.

Implementation Framework for Research Translation:

For effective translation of kdpC research into practical disease control applications, a systematic approach is recommended:

  • Validation in Field Conditions: Test laboratory findings about kdpC function under actual agricultural conditions, accounting for environmental variables like temperature (25-30°C optimal for Xcc growth) , humidity, and soil conditions.

  • Collaborative Research Networks: Establish partnerships between molecular biologists, plant pathologists, agronomists, and farmers to ensure research addresses practical challenges.

  • Economic and Environmental Assessment: Evaluate the cost-effectiveness and environmental impact of kdpC-targeted control strategies compared to conventional methods.

  • Knowledge Dissemination: Develop training programs for agricultural extension officers and farmers on implementing new control strategies based on kdpC research.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.