Recombinant Xanthomonas campestris pv. campestris Sensory/regulatory protein RpfC (rpfC)

Shipped with Ice Packs
In Stock

Description

Quorum Sensing and Virulence Regulation

RpfC partners with RpfG to form a two-component system (TCS) that perceives DSF-family signals (e.g., DSF, BDSF) . Key functions include:

  • DSF Binding: RpfC binds DSF (cis-11-methyl-2-dodecenoic acid) and BDSF (cis-2-dodecenoic acid) via its periplasmic sensor, inducing autophosphorylation .

  • c-di-GMP Modulation: Phosphorylated RpfG degrades cyclic di-GMP (c-di-GMP), downregulating biofilm formation and upregulating virulence factors (e.g., extracellular enzymes) .

Regulation of Type III Secretion System (T3SS)

RpfC directly activates hrpX, the master regulator of Xcc’s T3SS, independent of RpfG . Mutants lacking rpfC show:

  • 60–80% reduction in hrp cluster gene expression .

  • Delayed hypersensitive response (HR) in nonhost plants .

Signal Specificity and Activation

Signal MoleculeBinding AffinityAutokinase ActivationBiological Activity
DSFHighStrongVirulence factor synthesis
BDSFModerateWeakPartial virulence regulation
trans-BDSFLowNoneNo detectable activity

DSF binding induces conformational changes in RpfC, enabling autokinase activity and subsequent phosphotransfer to RpfG . Alanine substitution studies identified residues critical for DSF sensing (e.g., D17, S18, Q22) .

Genetic and Proteomic Impacts

Proteomic analysis of rpfC mutants revealed dysregulation of:

  • Oxidative Stress Response: Reduced catalase and superoxide dismutase .

  • Metabolism: Altered abundance of aspartate decarboxylase and enolase .

  • DNA Replication: Impaired helicase and ligase levels .

Applications in Research

Recombinant RpfC is utilized to:

  • Study Signal Transduction: Investigate DSF/RpfC/RpfG interactions via in vitro kinase assays .

  • Develop Anti-Virulence Strategies: Screen inhibitors targeting DSF-RpfC binding .

  • Elucidate Structural Mechanisms: Map domains critical for sensor-kinase coupling .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is crucial for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during production. If you require a particular tag, please specify it in your order; we will prioritize its development.
Synonyms
rpfC; XCC1856; Sensory/regulatory protein RpfC
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-726
Protein Length
full length protein
Species
Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
Target Names
rpfC
Target Protein Sequence
MKSPLPWLKRRLSGRADSEHAQNLIRIIITTLFISYLGWRYQHTHGDTLMATWLILVGEL LVSLGLMVAILLRPQVSHTRRLIGMLLDYTCTGAIMAIQGEPASPLYAVCMWVTIGNGLR YGSNYLRAATAMGSLCFLGAILISPYWKANPYLSWGLLLGLIAVPLYFDSLLRAMTRAVR EARHANQAKSRFLANMSHEFRTPLNGLSGMTEVLATTRLDAEQKECLNTIQASARSLLSL VEEVLDISAIEAGKIRIDRRDFSLREMIGSVNLILQPQARGRRLEYGTQVADDVPDLLKG DTAHLRQVLLNLVGNAVKFTEHGHVLLRVTRVSGSAEDAVRLRFDVEDTGIGVPMDMRPR LFEAFEQADVGLSRRYEGTGLGTTIAKGLVEAMGGSIGFKENQPSGSVFWFELPMAIGEP LKSSTVRVPTGALVDAPEELESSNIIAFSNPFLRHRARVRSMRMLVADDHEANRMVLQRL LEKAGHKVLCVNGAEQVLDAMAEEDYDAVIVDLHMPGMNGLDMLKQLRVMQASGMRYTPV VVLSADVTPEAIRACEQAGARAFLAKPVVAAKLLDTLADLAVSTRQLATPATTVQVATSF EGVLDSSVLDELAALGMGEEFERQFVRQCLDDAQNCVGDIERDGTCSDWEQLRESAHALR GVASNLGLAQVASSGGELMRMADWQLQAEWRLRLSTLREQLKAGKDALDARVQGVKDGEC SPRSNE
Uniprot No.

Target Background

Function

RpfC is a hybrid sensor kinase regulating diverse biological functions through dual mechanisms. At low cell density, extracellular diffusible signaling factor (DSF) concentration is sub-threshold. Unphosphorylated RpfC negatively regulates DSF synthesis by directly interacting with the DSF synthase RpfF, preventing DSF production and maintaining basal levels. This process is independent of the phosphorelay mechanism and RpfG. RpfC is also a component of the RpfG/RpfC two-component regulatory system involved in DSF perception and response, crucial for cell-cell signaling. At high cell density, increased extracellular DSF binds to RpfC's sensor region, inducing RpfC autophosphorylation. This releases RpfF and activates RpfG via a four-step phosphorelay, positively regulating biofilm dispersal and virulence factor production.

Database Links

KEGG: xcc:XCC1856

STRING: 190485.XCC1856

Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the function of RpfC in Xanthomonas campestris pv. campestris?

RpfC functions as a critical component of a two-component sensory transduction system in Xanthomonas campestris pv. campestris (Xcc). It works in conjunction with RpfG to perceive and transduce signals from the diffusible signal factor (DSF). The rpf gene cluster, which includes rpfC, is essential for the pathogenesis of this bacterium to plants. In laboratory settings, rpfC mutants exhibit distinctive growth characteristics, forming matrix-enclosed aggregates in L medium, whereas wild-type strains grow in a dispersed planktonic fashion . This phenotypic difference demonstrates RpfC's fundamental role in regulating bacterial lifestyle transitions between aggregated (biofilm) and planktonic states.

The protein serves as a histidine kinase receptor that directly binds to fatty acid-based signal factors, initiating a phosphorelay cascade that ultimately regulates numerous virulence-associated genes. Through this signaling pathway, RpfC contributes to the coordination of behaviors including extracellular enzyme production, extracellular polysaccharide synthesis, and biofilm formation and dispersal .

Which amino acid residues are critical for RpfC function?

Sequence alignment studies of RpfC orthologs from various species belonging to the Xanthomonadaceae family have revealed that amino acids 15-22 are highly conserved, indicating this region's functional importance . Alanine-scanning mutagenesis has identified specific amino acids essential for DSF recognition and signal transduction.

Several amino acid substitutions have been shown to significantly impact RpfC function:

  • D17A, S18A, and Q22A substitutions caused major reductions in promoter activity (to 22.9–32.9% of wild-type levels) in response to exogenous DSF

  • R15A and E19A substitutions resulted in intermediate reductions (39.0–66.1% of wild-type levels)

  • S3A replacement interestingly caused a significant increase in promoter activity (to 110.0% of control levels)

Additional substitution analyses demonstrated that functionally similar amino acids can sometimes maintain activity. For example, the R15K strain (substituting arginine with lysine) maintained similar activity levels to the wild type, suggesting that positively charged, polar residues with similar side chains are important at this position .

How does RpfC contribute to biofilm formation and dispersal?

RpfC plays a central role in the regulation of biofilm formation and dispersal in Xcc. Wild-type Xcc grows in a dispersed planktonic fashion in laboratory media, while rpfC mutants form matrix-enclosed aggregates. These aggregates represent a biofilm-like state that is dependent on the production of xanthan, an extracellular polysaccharide .

The regulatory mechanism functions as follows:

  • RpfF directs the synthesis of the diffusible signal factor (DSF)

  • RpfC, together with RpfG, perceives the DSF signal

  • This perception triggers a signaling cascade that regulates various cellular processes

  • Among these processes is the production of endo-β-1,4-mannanase, an extracellular enzyme that can disperse bacterial aggregates

Importantly, addition of DSF can trigger dispersion of aggregates formed by rpfF mutants (which cannot produce DSF), but not those formed by rpfC mutants (which cannot sense DSF). This indicates that RpfC is essential for transducing the DSF signal that leads to biofilm dispersal .

The biofilm lifestyle appears to be important for bacterial survival against environmental stresses, while the ability to transition to a planktonic state is crucial for efficient colonization of the plant vascular system during pathogenesis.

What are the optimal expression systems for producing recombinant RpfC protein?

The selection of an expression system for recombinant RpfC should consider the protein's structural characteristics and intended experimental applications. As a bacterial membrane-bound histidine kinase with multiple domains, RpfC presents several expression challenges.

Expression System Comparison for RpfC:

Expression SystemAdvantagesLimitationsRecommendations for RpfC
E. coli- Rapid expression
- High yield
- Economic feasibility
- Well-established protocols
- Limited post-translational modifications
- Challenges with membrane proteins
- Potential folding issues
- Suitable for cytoplasmic domains
- Consider specialized strains (C41/C43) for membrane domains
- May require optimization of codon usage
Pichia pastoris- Good protein folding
- Post-translational modifications
- High-density cultivation
- Longer development time
- Glycosylation patterns differ from native
- Potential alternative for full-length RpfC
- Useful for studies requiring properly folded protein
Baculovirus/insect cell- Advanced eukaryotic modifications
- Efficient for complex proteins
- Higher cost
- Technical complexity
- Longer production time
- Consider for functional studies requiring authentic structure
- Beneficial if E. coli expression is problematic
Mammalian cells- Most authentic modifications
- Natural folding environment
- Highest cost
- Lowest yield
- Most complex methodology
- Generally not necessary for bacterial proteins
- Consider only for specific interaction studies with eukaryotic partners

How can site-directed mutagenesis be used to investigate RpfC signal transduction?

Site-directed mutagenesis represents a powerful approach for investigating the structure-function relationships of RpfC and its signal transduction mechanism. Based on existing research, the following methodological framework is recommended:

  • Target Selection Strategy:

    • Focus on the highly conserved sensor region (amino acids 15-22)

    • Target residues identified through alanine scanning (D17, S18, Q22, R15, E19)

    • Include residues in the histidine phosphotransfer domain

    • Investigate the interface between sensor and histidine kinase domains

  • Experimental Design Approach:

    • Generate single amino acid substitutions using standard site-directed mutagenesis protocols

    • Create complementation constructs in appropriate vectors (e.g., pHM1)

    • Express mutated proteins in rpfC-deficient backgrounds

    • Assess function using reporter systems (e.g., GUS reporter fused to promoters of regulated genes like engXcc)

  • Functional Analysis Methods:

    • Measure DSF binding affinity using labeled DSF and mutant proteins

    • Assess autophosphorylation activity using [γ-32P]-ATP

    • Evaluate phosphotransfer to RpfG

    • Quantify downstream gene expression changes

    • Test biofilm formation and dispersal phenotypes

  • Advanced Substitution Strategies:

    • Conservative substitutions (maintain chemical properties): e.g., D17E, R15K

    • Non-conservative substitutions (alter chemical properties): e.g., D17A, S18A

    • Cross-species substitutions based on sequence alignments from different Xanthomonas species

Research has demonstrated that substitutions like RpfC L172A and RpfC A178D result in constitutively activated autophosphorylation, even in the absence of DSF signal, suggesting these residues are involved in maintaining the inactive conformation of the protein . Such constitutional mutants provide valuable tools for dissecting downstream signaling events independent of DSF binding.

What methods are effective for studying the RpfC-DSF interaction?

Understanding the molecular basis of RpfC-DSF interaction requires specialized techniques that can detect and characterize protein-small molecule binding. The following methodological approaches are recommended:

  • Biochemical Binding Assays:

    • Isothermal titration calorimetry (ITC) to determine binding constants and thermodynamic parameters

    • Surface plasmon resonance (SPR) using immobilized RpfC sensor domain

    • Fluorescence-based binding assays with labeled DSF molecules

    • Pull-down assays using DSF-conjugated matrices

  • Structural Biology Approaches:

    • X-ray crystallography of the sensor domain with bound DSF

    • NMR spectroscopy to map binding interfaces

    • Hydrogen-deuterium exchange mass spectrometry to identify conformational changes upon DSF binding

    • Cryo-electron microscopy for full-length RpfC structural studies

  • Functional Validation Methods:

    • In vitro autophosphorylation assays with purified RpfC in liposomes

    • Phosphotransfer assays to detect signaling to RpfG

    • Reporter gene assays in vivo using genes known to be regulated by the DSF/RpfC system

    • Biofilm formation and dispersal assays to measure physiological responses

  • Computational Approaches:

    • Molecular docking to predict DSF binding sites

    • Molecular dynamics simulations to understand conformational changes

    • Homology modeling based on related histidine kinases

    • Sequence conservation analysis to identify potentially important residues

Research has shown that the RpfC sensor domain directly binds DSF, with specific amino acids (particularly in the 15-22 region) playing critical roles in recognition . Liposome reconstitution systems with purified RpfC have been successfully used to demonstrate DSF-induced autophosphorylation, providing a valuable in vitro system for mechanistic studies.

How can researchers investigate cross-talk between RpfC and other signaling systems?

Investigating signaling cross-talk requires multifaceted approaches that integrate genetic, biochemical, and systems-level techniques. For studying RpfC's potential interactions with other signaling systems, the following methodological framework is recommended:

  • Genetic Approaches:

    • Construction of double/triple mutants combining rpfC mutations with mutations in other signaling pathways

    • Creation of chimeric proteins fusing domains from RpfC with those from other sensor kinases

    • Complementation studies with heterologous sensor domains

    • Transcriptional profiling of single versus multiple pathway mutants to identify genes regulated by multiple systems

  • Biochemical Methods:

    • In vitro phosphotransfer assays testing RpfC phosphorylation of non-cognate response regulators

    • Pull-down experiments to identify protein-protein interactions

    • Bacterial two-hybrid screening to detect direct interactions

    • Phosphoproteomics to map signaling networks

  • Systems Biology Approaches:

    • RNA-seq comparing transcriptomes of single and multiple pathway mutants

    • ChIP-seq to map the regulons of response regulators

    • Metabolomics to identify metabolites affected by signaling cross-talk

    • Network analysis to model interactions between signaling pathways

  • Reconstitution Experiments:

    • In vitro reconstitution of multiple signaling pathways

    • Cell-free expression systems to study pathway interactions

    • Liposome reconstitution with multiple sensor kinases to detect cross-phosphorylation

    • Physiological assays measuring outputs of multiple pathways simultaneously

Recent research indicates that the DSF/RpfC system in Xanthomonas may interact with other regulatory networks involved in virulence, stress responses, and biofilm formation. The histidine kinase domain of RpfC can potentially phosphorylate multiple response regulators, creating a branched signaling network that integrates multiple environmental cues .

What are the best methods for detecting RpfC-mediated signaling in vivo?

Detecting RpfC-mediated signaling in vivo requires reliable readouts that reflect the activity of the signaling pathway. The following methods have proven effective in Xanthomonas research:

  • Reporter Gene Systems:

    • GUS fusion to DSF-regulated promoters (e.g., engXcc promoter)

    • Luciferase reporters for real-time monitoring

    • Fluorescent protein reporters for single-cell analysis

    • β-galactosidase assays for quantitative measurements

  • Phenotypic Assays:

    • Extracellular protease (EXP) activity detection on agar plates

    • Biofilm formation quantification using crystal violet staining

    • Virulence assessment in plant infection models

    • Cell aggregation assays in liquid culture

  • Molecular Detection Methods:

    • qRT-PCR of known DSF-regulated genes

    • Western blotting for proteins whose expression is regulated by DSF

    • Enzyme activity assays (e.g., endo-β-1,4-mannanase)

    • Phosphospecific antibodies to detect RpfC phosphorylation state

  • Advanced Techniques:

    • Transcriptome analysis to detect global changes in gene expression

    • Phosphoproteomics to identify components phosphorylated in the signaling cascade

    • Metabolomics to detect changes in small molecule profiles

    • Live cell imaging with fluorescent biosensors

Experimental evidence shows that the extracellular protease activity assay provides a reliable visual indicator of RpfC signaling activity. When DSF is spotted near a bacterial colony on an appropriate medium, a protein degradation zone forms, the diameter of which correlates with signaling intensity . Similarly, the GUS reporter system fused to the engXcc promoter has been widely used to quantify DSF-RpfC signaling in various mutant backgrounds .

How can researchers generate and purify functional recombinant RpfC for in vitro studies?

Generating and purifying functional recombinant RpfC presents significant challenges due to its membrane-associated nature and multiple domains. The following methodological approach is recommended:

  • Construct Design Considerations:

    • Express full-length protein for complete functional studies

    • Express individual domains (sensor, HAMP, DHp, CA domains) for specific interaction studies

    • Include affinity tags (His6, GST, MBP) for purification, preferably at C-terminus

    • Consider fusion with MBP or SUMO to improve solubility

    • Design constructs with cleavable tags

  • Expression System Selection:

    • E. coli specialized strains (C41/C43, Rosetta) for membrane proteins

    • Cell-free expression systems for difficult-to-express constructs

    • Consider P. pastoris for full-length protein expression

    • Use bacterial expression for cytoplasmic domains

  • Optimized Purification Protocol:

    • For membrane domains:

      • Solubilize using mild detergents (DDM, LMNG)

      • Consider nanodiscs or amphipols for detergent-free handling

      • Utilize affinity chromatography followed by size exclusion

      • Validate protein folding by circular dichroism

    • For soluble domains:

      • Standard affinity chromatography

      • Ion exchange and size exclusion for higher purity

      • Concentrate to 1-5 mg/ml for functional studies

  • Functional Validation Methods:

    • DSF binding assays

    • Autophosphorylation assays using [γ-32P]-ATP

    • Liposome reconstitution for membrane-embedded proteins

    • Circular dichroism to confirm secondary structure integrity

For functional studies, researchers have successfully reconstituted RpfC in liposomes to study its autophosphorylation activity in response to DSF. This approach allows for controlled investigation of the signaling mechanism in a membrane-like environment. Importantly, mutations such as L172A and A178D have been shown to result in constitutively activated autophosphorylation, providing valuable positive controls for in vitro assays .

What approaches are effective for studying RpfC's role in Xanthomonas virulence?

Investigating RpfC's contribution to Xanthomonas virulence requires integrating molecular, cellular, and whole-organism approaches. The following methodological framework has proven effective:

  • Genetic Manipulation Strategies:

    • Generate clean deletion mutants of rpfC

    • Create point mutations in key functional residues

    • Develop complemented strains with wild-type and mutant alleles

    • Construct reporter strains to monitor virulence gene expression in planta

  • In Vitro Virulence Factor Assays:

    • Quantify extracellular enzyme production (proteases, cellulases)

    • Measure extracellular polysaccharide (xanthan) production

    • Assess biofilm formation capacity

    • Monitor motility on appropriate media

  • Plant Infection Models:

    • Cabbage (Brassica oleraceae) leaf infiltration for quantitative virulence assessment

    • Chinese radish (Raphanus sativus) infection for disease progression studies

    • Wound inoculation versus stomatal infiltration methods

    • Microscopy to track bacterial colonization and movement in planta

  • Advanced Analytical Techniques:

    • Transcriptomics to identify virulence genes regulated by RpfC in planta

    • Confocal microscopy with fluorescently labeled bacteria to visualize infection

    • Electron microscopy to examine biofilm formation in plant tissues

    • Mass spectrometry to identify secreted proteins during infection

Research has demonstrated that RpfC mutants have significantly reduced virulence in plant hosts. For example, mutations affecting RpfC's ability to sense DSF result in decreased virulence scores in cabbage infection assays . Interestingly, certain mutations that constitutively activate RpfC signaling (L172A and A178D) can partially suppress the virulence defects caused by sensor domain mutations, highlighting the importance of the signaling pathway's activation state rather than just DSF sensing .

The involvement of endo-β-1,4-mannanase in virulence is particularly noteworthy, as this enzyme is positively regulated by the DSF/RpfC system and is required for full virulence. This suggests that RpfC's control of the transition between biofilm and planktonic lifestyles via mannanase production is a key aspect of its contribution to pathogenesis .

How should researchers interpret conflicting results from different RpfC expression systems?

When different expression systems yield conflicting results for recombinant RpfC studies, a systematic analytical approach is essential to resolve these discrepancies. The following framework is recommended:

  • System-Specific Considerations:

    • E. coli expression may lack proper folding or post-translational modifications

    • Eukaryotic systems might introduce non-native modifications

    • Fusion tags can interfere with protein function

    • Expression conditions affect protein conformation and activity

  • Analytical Resolution Steps:

    • Compare protein purity and integrity by SDS-PAGE and Western blotting

    • Verify proper folding using circular dichroism or limited proteolysis

    • Assess aggregation state by size exclusion chromatography

    • Validate functional activity through multiple independent assays

  • Validation Strategy:

    • Test proteins from different systems in the same functional assay

    • Perform complementation testing in bacterial mutants

    • Conduct structural analyses to compare conformational states

    • Use native RpfC (non-recombinant) as benchmark where possible

  • Reconciliation Approaches:

    • Identify system-specific artifacts through systematic comparison

    • Determine if differences represent physiologically relevant states

    • Consider if conflicting results reflect different functional contexts

    • Develop a unified model that accommodates apparently conflicting data

For RpfC specifically, the membrane-associated nature of the protein makes it susceptible to expression system artifacts. When E. coli-expressed RpfC shows different activity compared to P. pastoris-expressed protein, researchers should consider whether proper membrane integration has occurred. Similarly, the sensor domain's interaction with DSF may be affected by the lipid environment, which differs between expression systems .

When reconciling data, focus on core functional readouts like autophosphorylation activity, DSF binding, and the ability to complement rpfC mutant phenotypes in Xanthomonas.

What statistical approaches are appropriate for analyzing RpfC mutant phenotypes?

Statistical analysis of RpfC mutant phenotypes requires careful consideration of the experimental design and data characteristics. The following approaches are recommended:

  • Appropriate Statistical Tests:

    • Student's t-test for comparing two experimental conditions (e.g., wild-type vs. single mutant)

    • ANOVA with post-hoc tests (Tukey's HSD, Dunnett's) for multiple comparisons

    • Non-parametric tests (Mann-Whitney, Kruskal-Wallis) when normality cannot be assumed

    • Repeated measures designs for time-course experiments

  • Experimental Design Considerations:

    • Use biological replicates (n=3 minimum) rather than technical replicates alone

    • Include appropriate controls (positive, negative, vehicle)

    • Blind scoring for subjective measurements (e.g., virulence scoring)

    • Randomize experimental units to avoid batch effects

  • Data Presentation Recommendations:

    • Show individual data points alongside means and standard deviations

    • Use consistent scaling across comparable experiments

    • Present both raw data and normalized data where appropriate

    • Include statistical significance indicators with exact p-values

  • Advanced Analytical Approaches:

    • Dose-response curves for DSF concentration studies

    • Principal component analysis for multi-parameter phenotyping

    • Cluster analysis for grouping functionally similar mutants

    • Machine learning for complex phenotype classification

In published research on RpfC, statistical significance is typically evaluated using Student's t-test when comparing mutant strains to control strains, with p ≤ 0.05 considered statistically significant . For virulence assays, data from multiple plants (typically n=8-10) should be collected and analyzed using appropriate statistical methods to account for biological variability.

When analyzing promoter activity data (e.g., GUS assays), normalization to control conditions is common, but presenting both raw and normalized data provides important context for interpretation. For complex phenotypes like biofilm formation, multiple quantitative measures should be combined with qualitative observations for comprehensive assessment.

How can CRISPR-Cas systems be utilized for studying RpfC function in Xanthomonas?

CRISPR-Cas technology offers powerful new approaches for investigating RpfC function in Xanthomonas. The following methodological framework is recommended:

  • Genome Editing Applications:

    • Generate precise rpfC gene knockouts without polar effects

    • Create point mutations to study specific amino acid functions

    • Introduce epitope tags for protein detection

    • Engineer regulatory element modifications to alter expression levels

  • CRISPR Interference (CRISPRi) Approaches:

    • Achieve tunable repression of rpfC expression

    • Target upstream regulators to identify regulatory networks

    • Repress multiple genes simultaneously to study pathway interactions

    • Create conditional knockdowns for essential genes

  • CRISPR Activation (CRISPRa) Strategies:

    • Upregulate rpfC expression for gain-of-function studies

    • Activate genes in the DSF/RpfC regulon to bypass signaling

    • Create synthetic regulatory circuits

    • Implement inducible activation systems

  • Implementation Considerations:

    • Optimize Cas9/Cas12a expression for Xanthomonas

    • Design efficient delivery systems (plasmid-based or integrative)

    • Select appropriate promoters for guide RNA expression

    • Develop screening methods for edited strains

The application of CRISPR technology enables precise manipulation of the rpfC gene at the chromosomal level, avoiding artifacts associated with plasmid-based complementation. This approach can facilitate the creation of an allelic series of mutations that would be challenging with traditional methods. For instance, researchers could generate a series of single amino acid substitutions in the sensor domain to create a comprehensive structure-function map .

Additionally, CRISPRi could be used to create a gradient of RpfC expression levels, allowing for the study of dosage effects on signaling and virulence—an aspect that has not been extensively investigated in previous research.

What emerging technologies show promise for studying RpfC-mediated signaling dynamics?

Several cutting-edge technologies are poised to revolutionize our understanding of RpfC-mediated signaling dynamics. The following approaches show particular promise:

  • Advanced Imaging Technologies:

    • Single-molecule tracking to visualize RpfC localization and dynamics

    • FRET-based biosensors to detect RpfC-RpfG interactions in real-time

    • Super-resolution microscopy to examine membrane distribution

    • Light-sheet microscopy for in planta imaging during infection

  • Synthetic Biology Approaches:

    • Engineered cell-based biosensors for DSF detection

    • Orthogonal two-component systems to study pathway specificity

    • Optogenetic control of RpfC activity for temporal studies

    • Minimal synthetic circuits to reconstitute core signaling functions

  • Structural Biology Innovations:

    • Cryo-electron microscopy for full-length RpfC structure

    • Hydrogen-deuterium exchange mass spectrometry for conformational dynamics

    • Cross-linking mass spectrometry to map protein-protein interactions

    • Microcrystal electron diffraction for challenging structural components

  • Systems Biology Integration:

    • Multi-omics approaches combining transcriptomics, proteomics, and metabolomics

    • Machine learning for pathway modeling and prediction

    • Single-cell RNA-seq to capture population heterogeneity

    • Spatial transcriptomics to map gene expression during infection

These emerging technologies can address current knowledge gaps in RpfC signaling. For example, the temporal dynamics of signaling activation and the potential for signal amplification remain poorly understood. Single-molecule tracking combined with fluorescent biosensors could reveal how quickly RpfC responds to DSF and how the signal propagates through bacterial populations.

Furthermore, synthetic biology approaches could help determine the minimal components required for functional DSF sensing and signal transduction, potentially enabling the engineering of synthetic sensors for agricultural applications in detecting Xanthomonas infections before visible symptoms appear.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.