Recombinant Xanthomonas campestris pv. campestris Type II secretion system protein F (xpsF)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
xpsF; pefF; XCC0661; Type II secretion system protein F; T2SS protein F; General secretion pathway protein F
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-405
Protein Length
full length protein
Species
Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
Target Names
xpsF
Target Protein Sequence
MPLYRYKALDAHGEMLDGQMEAANDAEVALRLQEQGHLPVETRLATGENGSPSLRMLLRK KPFDNAALVQFTQQLATLIGAGQPLDRALSILMDLPEDDKSRRVIADIRDTVRGGAPLSV ALERQHGLFSKLYINMVRAGEAGGSMQDTLQRLADYLERSRALKGKVINALIYPAILLAV VGCALLFLLGYVVPQFAQMYESLDVALPWFTQAVLSVGLLVRDWWLVLVVIPGVLGLWLD RKRRNAAFRAALDAWLLRQKVIGSLIARLETARLTRTLGTLLRNGVPLLAAIGIARNVMS NTALVEDVAAAADDVKNGHGLSMSLARGKRFPRLALQMIQVGEESGALDTMLLKTADTFE LETAQAIDRALAALVPLITLVLASVVGLVIISVLVPLYDLTNAIG
Uniprot No.

Target Background

Function
A component of the type II secretion system's inner membrane complex. It is essential for the energy-dependent secretion of extracellular factors, such as proteases and toxins, from the periplasm.
Database Links

KEGG: xcc:XCC0661

STRING: 190485.XCC0661

Protein Families
GSP F family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the role of xpsF in the Type II secretion system of Xanthomonas campestris pv. campestris?

xpsF is a critical component of the inner membrane assembly platform of the Type II secretion system in Xcc. It works in conjunction with other proteins including xpsE (the ATPase), xpsL, xpsM, and xpsN to form a dynamic hexameric hub that drives the secretion process. The T2SS as a whole functions to transport virulence factors, toxins, and degradative enzymes across the bacterial outer membrane, playing a direct role in Xcc pathogenicity .

The relative stoichiometric ratio of the inner membrane assembly proteins approximates 2:1:1:1:1 (for the xpsC:xpsE:xpsL:xpsM:xpsN homologs), demonstrating the organized architecture of this complex machinery. xpsF specifically contributes to maintaining the structural integrity of this assembly and facilitates the energy transfer from ATP hydrolysis to the mechanical work of substrate translocation.

How does the xpsF protein interact with other components of the T2SS machinery?

xpsF functions as part of the inner membrane platform, forming intricate interactions with other T2SS components. Research has shown that:

  • xpsF forms direct protein-protein interactions with xpsE (the ATPase powering the system)

  • It connects to xpsL and xpsM to form the hexameric hub structure

  • It interacts with the periplasm-spanning components to link the inner platform with the outer membrane complex

What genomic features characterize the xpsF gene in Xcc strain 8004?

The xpsF gene in Xcc strain 8004 is part of the larger xps gene cluster encoding the T2SS components. Analysis of the Xcc 8004 genome (total size: 5,148,708 bp) reveals several notable features:

  • The gene encodes a protein that is highly conserved across Xanthomonas species

  • It is co-regulated with other T2SS components, showing coordinated expression

  • The genomic organization places it in proximity to other xps genes, facilitating coordinated expression

Comparative genomic analyses between Xcc strains (such as 8004 and ATCC 33913) show that while significant genomic rearrangements have occurred, the xps gene cluster remains relatively conserved, highlighting its functional importance .

What are the most effective transformation methods for introducing recombinant xpsF constructs into Xcc?

For efficient transformation of Xcc with recombinant xpsF constructs, an optimized electroporation method has proven most effective. This approach offers significantly higher transformation efficiencies (up to 100-fold improvement) compared to traditional methods.

Recommended Protocol:

  • Grow Xcc 8004 to OD600 = 0.8 (optimal growth stage for electroporation)

  • Treat overnight cultures with sucrose solution

  • Micro-centrifuge at room temperature

  • Electroporate with the following parameters:

    • Electrode gap: 0.1 cm

    • Field strength: 14 KV/cm

    • DNA concentration: 200 ng for replicative plasmids, ≥500 ng for non-replicative plasmids

    • Recovery time: 2 hours at 28°C before plating

This protocol achieves transformation efficiencies of approximately 10^9 transformants per microgram of DNA for replicative plasmids and 150 transformants per microgram for non-replicative plasmids .

ParameterOptimal ValueEffect on Transformation Efficiency
Cell Growth StageOD600 = 0.8Maximal competence at this density
DNA Concentration200-500 ngLinear increase up to saturation
Field Strength14 KV/cmBalance between efficiency and cell survival
Recovery Time2 hoursAllows for expression of selection markers

How can researchers verify successful expression of recombinant xpsF?

Verification of recombinant xpsF expression requires a multi-faceted approach:

  • RT-PCR analysis: To confirm transcription of the xpsF gene

  • Western blot: Using specific antibodies to detect xpsF protein expression

  • Functional complementation assays: Testing whether the recombinant xpsF restores secretion in xpsF-deficient mutants

  • Co-immunoprecipitation: To verify interaction with known T2SS partners (xpsE, xpsL, etc.)

For Western blot analysis, samples should be prepared carefully to maintain protein integrity:

  • Harvest cells during log phase

  • Fractionate to separate inner membrane proteins

  • Use appropriate detergents (e.g., n-dodecyl β-D-maltoside) to solubilize membrane proteins

  • Include positive controls (known xpsF-expressing strains) and negative controls (xpsF deletion mutants)

What methods are recommended for purifying recombinant xpsF for structural studies?

Purifying recombinant xpsF presents significant challenges due to its membrane-associated nature. Successful purification requires:

  • Expression system optimization:

    • Use of specialized E. coli strains (C41/C43) designed for membrane protein expression

    • Inclusion of appropriate fusion tags (His6, MBP, or SUMO) to enhance solubility

    • Controlled induction at lower temperatures (16-18°C)

  • Extraction protocol:

    • Solubilization using mild detergents (DDM, LMNG, or other amphipols)

    • Two-phase extraction methods for membrane proteins

    • Buffer optimization to maintain protein stability

  • Purification approach:

    • Initial IMAC (immobilized metal affinity chromatography) for tag-based capture

    • Size exclusion chromatography to remove aggregates

    • Optional ion exchange chromatography for further purification

Structural integrity verification can be performed using:

  • Circular dichroism to assess secondary structure

  • Limited proteolysis to confirm folding

  • Analytical ultracentrifugation to assess oligomeric state

How does ATP hydrolysis by xpsE mechanistically couple to xpsF function in the T2SS?

The coupling between ATP hydrolysis by xpsE and xpsF function represents a critical aspect of T2SS mechanics. Current models suggest a conformational relay mechanism:

  • The xpsE hexamer undergoes conformational changes upon ATP binding and hydrolysis

  • These changes are transmitted to xpsF via direct protein-protein interactions

  • xpsF subsequently relays these conformational signals to other components of the inner membrane platform

  • This leads to pseudo-pilus assembly and extension, driving substrate movement through the secretin channel

Recent research demonstrates that xpsF acts as a structural adaptor that connects the ATPase activity to mechanical work. Mutational studies targeting the xpsE-xpsF interface have shown that disrupting this interaction abolishes secretion activity without affecting complex assembly, highlighting the essential role of this energy transduction pathway .

What structural domains in xpsF are critical for its function, and how can they be experimentally manipulated?

xpsF contains several functionally important domains that can be targeted for experimental manipulation:

  • Transmembrane (TM) domains: Typically 1-2 TM helices that anchor the protein in the inner membrane

  • Cytoplasmic domain: Interacts with the xpsE ATPase

  • Periplasmic domain: Connects to other components of the secretion machinery

Experimental approaches to study these domains include:

  • Domain mapping through truncation mutants: Systematically deleting portions of xpsF to identify minimal functional units

  • Site-directed mutagenesis: Targeting conserved residues identified through sequence alignments across bacterial species

  • Domain swapping: Exchanging domains between xpsF homologs from different species to assess functional conservation

  • Cysteine scanning mutagenesis: Introducing single cysteines throughout the protein for subsequent labeling to probe structure

How do post-translational modifications affect xpsF function in the context of T2SS assembly and activity?

Post-translational modifications (PTMs) potentially play regulatory roles in xpsF function, though this area remains less explored compared to structural studies. Research approaches should consider:

  • Identification of potential PTMs:

    • Mass spectrometry analysis of purified xpsF to identify phosphorylation, acetylation, or other modifications

    • Comparison between active and inactive states of the T2SS

  • Functional assessment:

    • Site-directed mutagenesis of modified residues (e.g., substituting phosphomimetic residues)

    • In vitro reconstitution of the modification using purified kinases or other modifying enzymes

  • Temporal dynamics:

    • Examination of PTM patterns during different growth phases

    • Analysis under various environmental conditions relevant to plant infection

While databases like PhosphoSitePlus have extensively cataloged PTMs in many proteins, specific information on xpsF modifications remains limited, representing an opportunity for novel research contributions .

How should researchers approach the analysis of xpsF mutant phenotypes in the context of plant virulence studies?

Analyzing xpsF mutant phenotypes requires a systematic approach that distinguishes direct effects from secondary consequences. Recommended methodologies include:

  • Comprehensive phenotypic characterization:

    • Growth curves in various media to assess general fitness

    • Biofilm formation assays to evaluate community behavior

    • Secretion assays targeting known T2SS substrates

    • Plant infection assays using appropriate host plants (e.g., Brassica oleraceae)

  • Complementation analysis:

    • Expression of wild-type xpsF in trans to confirm phenotype specificity

    • Use of xpsF variants with targeted mutations to map functional domains

  • Statistical approaches:

    • Biological replicates (minimum n=3) for all experiments

    • Appropriate statistical tests based on data distribution

    • Multi-factor analysis when evaluating complex phenotypes

  • Integration with transcriptomic/proteomic data:

    • RNA-Seq analysis to identify compensatory changes in gene expression

    • Proteomic analysis of secreted fractions to identify affected substrates

Plant virulence studies should employ standardized infection protocols and quantitative assessment methods to enable meaningful comparisons across different xpsF mutants .

What analytical approaches are recommended for interpreting structural data of the xpsF protein in the context of the complete T2SS?

Structural analysis of xpsF requires integration of multiple data types and computational approaches:

  • Integration of structural techniques:

    • X-ray crystallography for high-resolution domain structures when possible

    • Cryo-electron microscopy for the context of the whole T2SS complex

    • SAXS (Small Angle X-ray Scattering) for solution structures and conformational states

    • NMR for dynamic regions and protein-protein interfaces

  • Computational methods:

    • Molecular dynamics simulations to model conformational changes

    • Homology modeling based on related proteins when direct structural data is limited

    • Coevolution analysis to predict interacting interfaces

  • Data validation approaches:

    • Cross-validation between different structural techniques

    • Functional validation through targeted mutagenesis of predicted key residues

    • Comparison with homologous systems from related bacteria

When reporting structural data, researchers should adhere to established guidelines for X-ray photoelectron spectroscopy (XPS) and other analytical techniques to ensure reproducibility and reliability of results .

What emerging technologies might advance our understanding of xpsF dynamics during the secretion process?

Several cutting-edge technologies show promise for illuminating xpsF dynamics:

  • Single-molecule techniques:

    • FRET (Fluorescence Resonance Energy Transfer) to track conformational changes

    • Single-particle tracking in live cells to monitor protein movement

    • Super-resolution microscopy (STORM, PALM) to visualize T2SS assembly

  • Time-resolved structural approaches:

    • Time-resolved cryo-EM to capture different states of the secretion process

    • Temperature-jump techniques coupled with rapid spectroscopic methods

    • Hydrogen-deuterium exchange mass spectrometry for conformational dynamics

  • In situ structural biology:

    • Cryo-electron tomography of intact bacterial cells

    • Correlative light and electron microscopy to connect dynamics to structure

    • In-cell NMR to monitor protein behavior in the native environment

  • Artificial intelligence applications:

    • Machine learning for prediction of dynamic behaviors from static structures

    • Deep learning for image analysis of complex secretion system assemblies

    • Structure prediction tools like AlphaFold2 for modeling xpsF variants

What quality control measures should be implemented when working with recombinant xpsF?

Ensuring reproducibility in xpsF research requires rigorous quality control:

  • Plasmid verification:

    • Complete sequencing of all constructs

    • Restriction enzyme analysis to confirm plasmid integrity

    • Stability testing through multiple passages

  • Protein quality assessment:

    • SDS-PAGE with Western blotting to verify molecular weight and purity

    • Mass spectrometry to confirm protein identity and detect modifications

    • Circular dichroism to assess proper folding

    • Functional assays to confirm activity

  • Strain validation:

    • Genotypic verification through PCR

    • Phenotypic confirmation through secretion assays

    • Whole genome sequencing to identify potential suppressor mutations

  • Documentation standards:

    • Comprehensive recording of experimental conditions

    • Detailed reporting of all quality control results

    • Inclusion of all relevant experimental parameters in publications

When reporting research findings, all these quality control measures should be comprehensively documented according to established reporting standards to ensure reproducibility .

How can researchers troubleshoot common issues in xpsF expression and functional studies?

Researchers frequently encounter challenges when working with membrane proteins like xpsF. Here are systematic approaches to common problems:

  • Poor expression yields:

    • Optimize codon usage for the expression host

    • Test different fusion tags (His, MBP, SUMO, GST)

    • Evaluate alternative expression hosts (E. coli C41/C43, cell-free systems)

    • Lower induction temperature (16-18°C) and inducer concentration

  • Protein aggregation:

    • Screen different detergents (DDM, LDAO, digitonin, LMNG)

    • Include stabilizing additives (glycerol, specific lipids)

    • Optimize buffer conditions (pH, salt concentration)

    • Consider nanodiscs or amphipol reconstitution

  • Non-functional protein:

    • Verify correct folding through limited proteolysis

    • Assess oligomeric state through size exclusion chromatography

    • Compare activity with natively expressed protein

    • Test refolding protocols if necessary

  • Inconsistent secretion assays:

    • Standardize growth conditions and collection timepoints

    • Include positive and negative controls in each assay

    • Quantify secreted proteins using appropriate standards

    • Consider environmental factors affecting T2SS activity

Common IssuePotential CausesTroubleshooting Approach
Low transformation efficiencyDNA quality, cell competencePurify plasmid, optimize electroporation parameters
Poor xpsF expressionToxicity, codon bias, promoter strengthTest induction conditions, expression strains, fusion tags
Protein degradationProtease activity, instabilityAdd protease inhibitors, optimize buffer conditions
No complementation of xpsF mutantExpression level, tagging interferenceTry different promoters, tag positions, or tagless constructs
No detectable protein-protein interactionsBuffer conditions, transient interactionsCross-linking, optimize co-IP conditions, use proximity labeling

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.