Recombinant Xanthomonas campestris pv. campestris Type II secretion system protein L (pefL)

Shipped with Ice Packs
In Stock

Description

Biological Role in Virulence

PefL functions as a core component of the Xanthomonas Xps-T2SS, which secretes degradative enzymes to breach plant cell walls during infection ( ).

Key substrates secreted via T2SS in Xanthomonas spp.:

Enzyme ClassFunction in PathogenesisVirulence Impact
XylanasesDegrade xylan in plant cell wallsFacilitates tissue maceration
ProteasesDisrupt host defense proteinsEnhances bacterial colonization
LipasesModify plant membrane lipidsPromotes nutrient acquisition

Mutational studies show that T2SS-deficient X. campestris strains exhibit:

  • 60-75% reduction in protease/xylanase activity ( )

  • 50% decrease in in planta growth ( )

  • Attenuated symptom development in host plants

Production and Purification

The recombinant protein is expressed in E. coli BL21(DE3) strains using optimized codon sequences ( ):

Expression Parameters

ParameterDetail
VectorpET-based plasmid
Induction0.5 mM IPTG at 18°C for 16-20 hrs
PurificationNi-NTA affinity chromatography
Yield1-5 mg/L culture
ApplicationsEnzyme activity assays, antibody production

Notably, glycerol (5-50%) is recommended for long-term storage to prevent aggregation ( ).

Regulatory Mechanisms

PefL expression is tightly controlled through a hierarchical regulatory network:

  • Transcriptional Control:

    • Activated by HrpG/HrpX regulators of the type III secretion system (T3SS) ( )

    • Repressed under nutrient-limited conditions

  • Post-Translational Modifications:

    • Interacts with T2SS components XpsE and XpsF for apparatus assembly ( )

    • Requires ATPase XpsN for energy-dependent secretion

Cross-Species Comparisons

Homologs of pefL in other pathogens exhibit functional conservation but substrate specificity differences:

OrganismProteinSecreted SubstratesIdentity to pefL
Pseudomonas aeruginosaXcpYElastase, phospholipases68%
Vibrio choleraeEpsLCholera toxin, hemagglutinin72%
Pectobacterium carotovorumOutLPectate lyases, cellulases65%

This variability explains species-specific T2SS functionalities ( ).

Research Applications

  • Pathogenesis Studies: Used to dissect T2SS contributions to Xanthomonas virulence ( )

  • Protein Interaction Mapping: Identified binding partners via yeast two-hybrid screens ( )

  • Biotechnological Tool: Platform for secreting heterologous proteins in engineered bacterial systems

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
pefL; xpsL; XCC0667; Type II secretion system protein L; T2SS protein L; General secretion pathway protein L
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-373
Protein Length
full length protein
Species
Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
Target Names
pefL
Target Protein Sequence
MTAWRDTLGRIGVRAMPGAGGFWRWWQQSLLAWLPQRWQWQLGLSQSRLLLQLDGEALQL LRQRDQTSDTVASLPWPVQPQEVNALLPTALEGLPQHWLLPASHALRRPLRLPAAAAARL QDVARFEIDRQTPFTADQVYFDARVLDVREDGQLDAELVVVPRRMIDGPAGVPEAWSNAL SGIDVADARGAPLGVNLLPPARRLRRSDPMQRWNLLLAVAALVLLAVAGWLLLDNRRQAA DDLRAQVQANAGRARQVAAERQQLLELVEGAAFFQEQRATRPTSVEIWDELSRRLPSGTY LEKFSVEGGQLQLIGLSKEASSLVRRLEGSPLWHTPSLTGVLQSDAGRNVDRFTITAELA GPDAKEAADAAQR
Uniprot No.

Target Background

Function

Recombinant Xanthomonas campestris pv. campestris Type II secretion system protein L (pefL) is an inner membrane component of the type II secretion system. It's essential for the energy-dependent secretion of extracellular factors, such as proteases and toxins, from the periplasm. This protein plays a crucial role in complex assembly, recruiting XpsM to form a stable inner membrane complex. This interaction links the cytoplasmic energy-providing XpsE protein to the rest of the T2SS machinery.

Database Links

KEGG: xcc:XCC0667

STRING: 190485.XCC0667

Protein Families
GSP L family
Subcellular Location
Cell inner membrane; Single-pass membrane protein.

Q&A

What is the role of Type II secretion system protein L (pefL) in Xanthomonas campestris pv. campestris virulence?

Type II secretion system protein L (pefL) is a critical component of the T2S machinery in Xanthomonas campestris pv. campestris. The T2S system facilitates the secretion of degradative enzymes such as xylanases, proteases, and lipases into the extracellular environment, which mediate the degradation of plant cell wall components during host-pathogen interactions . Studies with mutant strains have demonstrated that these secreted enzymes significantly contribute to bacterial virulence and in planta growth . PefL (also known as XpsL) specifically functions as a structural component of the secretion apparatus, enabling the translocation of these virulence factors across the bacterial outer membrane.

What are the optimal conditions for expressing recombinant pefL protein?

For optimal expression of recombinant pefL protein, researchers should consider:

  • Expression system selection: E. coli BL21(DE3) strains are commonly used for recombinant expression of bacterial proteins like pefL.

  • Temperature modulation: Lower induction temperatures (16-20°C) often improve proper folding and solubility.

  • Induction protocol: IPTG concentration should be optimized (typically 0.1-0.5 mM) with induction periods of 4-16 hours.

  • Buffer composition: Tris-based buffers (pH 7.5-8.0) with glycerol (as noted in the storage conditions) help maintain protein stability .

  • Solubility enhancement: Addition of mild detergents may improve solubility of membrane-associated proteins like pefL.

The full-length protein (373 amino acids) should be expressed with appropriate tags for purification and detection purposes .

How can I design primers for amplifying the pefL gene from Xanthomonas campestris pv. campestris?

When designing primers for amplifying the pefL gene:

  • Reference sequence verification: Use the complete gene sequence (locus name XCC0667) as reference .

  • Primer design parameters:

    • Design primers with 18-25 nucleotides complementary to the target sequence

    • Maintain GC content between 40-60%

    • Ensure similar melting temperatures for forward and reverse primers (within 2-3°C)

    • Add appropriate restriction sites with 3-6 extra bases at the 5' end for subsequent cloning

    • Check for self-complementarity and hairpin formation

  • PCR optimization:

    • Use a high-fidelity DNA polymerase to minimize errors

    • Optimize annealing temperature (typically start with Tm-5°C)

    • Consider GC content of Xanthomonas genome when optimizing PCR conditions

  • Validation: Sequence the amplified product to confirm correct amplification before proceeding with cloning.

How should I design experiments to study the interaction between pefL and other components of the Type II secretion system?

To study protein-protein interactions within the T2S system involving pefL, a multi-faceted experimental approach is recommended:

Table 1: Experimental approaches for studying pefL interactions

MethodApplicationAdvantagesLimitations
Bacterial Two-HybridIn vivo screeningIdentifies direct protein interactionsMay miss weak interactions
Co-immunoprecipitationProtein complex isolationCaptures native complexesRequires specific antibodies
Pull-down assaysVerification of interactionsControlled conditionsArtificial binding conditions
Cross-linkingCapturing transient interactionsIdentifies dynamic associationsPotential for artifacts
Microscale thermophoresisBinding affinity measurementQuantitative binding constantsRequires protein labeling
Structural analysis (X-ray, Cryo-EM)Detailed interaction mappingAtomic-level resolutionTechnically challenging

For comprehensive analysis:

  • Begin with screening methods to identify potential interaction partners

  • Validate interactions using multiple complementary approaches

  • Quantify binding affinities for significant interactions

  • Create genetic constructs with site-directed mutations to map interaction domains

  • Correlate in vitro findings with functional studies in bacterial cells

What experimental design is most appropriate for studying the contribution of pefL to Xanthomonas campestris virulence?

An effective experimental design requires:

  • Systematic mutant generation:

    • Create a clean deletion mutant (ΔpefL)

    • Develop complemented strains with wild-type pefL

    • Generate site-directed mutants targeting functional domains

    • Include appropriate controls (wild-type strain, unrelated gene deletion)

  • Multi-level phenotyping:

    • Secretion assays to quantify enzyme secretion (proteases, xylanases, lipases)

    • Plant infection assays using appropriate host plants (typically pepper or cabbage)

    • Quantitative virulence measurements (lesion size, bacterial growth in planta)

    • Microscopy studies to visualize infection progression

  • Statistical analysis approach:

    • Use factorial design to evaluate multiple variables

    • Employ ANOVA for comparing multiple strains

    • Implement appropriate replication (biological and technical)

    • Calculate significance levels and effect sizes

  • Controls for experimental validity:

    • Include positive controls (known virulence gene mutations)

    • Implement negative controls (non-pathogenic strains)

    • Verify genetic stability of constructs throughout experiments

This design allows for robust assessment of both quantitative differences in virulence and mechanistic insights into pefL function .

How can I differentiate between the roles of T2S-dependent secretion and outer membrane vesicle transport of pefL-dependent substrates?

Differentiating between these two secretion mechanisms requires a carefully planned experimental approach:

  • Genetic dissection strategy:

    • Generate mutants in the T2S system (ΔpefL, other T2S components)

    • Create mutants in OMV biogenesis pathways

    • Develop double mutants affecting both pathways

  • Biochemical fractionation:

    • Use ultracentrifugation to isolate OMVs

    • Employ two-phase separation to isolate secreted proteins

    • Perform proteomic analysis on separated fractions

  • Microscopy techniques:

    • Utilize immunogold electron microscopy to localize proteins of interest

    • Label proteins with fluorescent tags for live-cell imaging

    • Quantify co-localization with known markers

  • Sequential analysis workflow:

    • Step 1: Characterize secretome profiles of wild-type vs. mutant strains

    • Step 2: Separate OMV fraction from truly soluble secreted proteins

    • Step 3: Identify proteins present in each fraction by mass spectrometry

    • Step 4: Validate findings with targeted protein detection methods

    • Step 5: Correlate with virulence phenotypes

Research indicates that T2S substrates can be detected in outer membrane vesicles, suggesting OMVs provide an alternative transport route for type II secreted extracellular enzymes in Xanthomonas campestris pv. vesicatoria .

What statistical approaches should I use when analyzing the impact of pefL mutations on bacterial virulence?

Analysis of virulence data requires robust statistical methods:

  • Data preprocessing:

    • Test for normality using Shapiro-Wilk or Kolmogorov-Smirnov tests

    • Apply appropriate transformations if data violates assumptions

    • Identify and handle outliers using standardized methods

  • Statistical test selection:

    • For comparing multiple strains: One-way ANOVA followed by post-hoc tests (Tukey HSD, Bonferroni)

    • For time-course experiments: Repeated measures ANOVA or mixed-effects models

    • For non-normally distributed data: Non-parametric alternatives (Kruskal-Wallis, Mann-Whitney U)

  • Advanced analytical approaches:

    • Multiple regression analysis to identify factors contributing to virulence

    • Principal component analysis for multivariate data reduction

    • Survival analysis for time-to-symptom data

    • Machine learning approaches for complex pattern recognition

  • Visualization techniques:

    • Create forest plots to compare effect sizes across experiments

    • Use heat maps to visualize patterns across multiple conditions

    • Employ violin plots to show full distribution of virulence data

  • Reporting standards:

    • Include appropriate effect sizes and confidence intervals

    • Report exact p-values rather than significance thresholds

    • Document all statistical tests and assumptions in methods section

Statistical power calculations should guide sample size determinations, typically aiming for 80-90% power to detect biologically relevant effect sizes.

How can I resolve contradictory data between T2S substrate specificities in different Xanthomonas pathovars?

When facing contradictory data between pathovars, implement this systematic resolution approach:

  • Source verification:

    • Confirm genetic identity of strains used (whole genome sequencing)

    • Verify experimental conditions are truly comparable

    • Check for inconsistencies in methodology that might explain differences

  • Comparative experimentation:

    • Test both pathovars simultaneously under identical conditions

    • Create chimeric constructs to isolate strain-specific factors

    • Use reciprocal complementation studies with genes from each pathovar

  • Systematic review methodology:

    • Classify contradictions by type (qualitative vs. quantitative)

    • Weight evidence based on methodological rigor

    • Identify variables that correlate with observed differences

  • Evolutionary context analysis:

    • Examine phylogenetic relationships between pathovars

    • Conduct comparative genomics to identify genetic differences

    • Consider host adaptation as a driver of secretion system evolution

  • Mechanistic explanation development:

    • Formulate testable hypotheses that might explain differences

    • Develop molecular models of substrate recognition

    • Test predictions through targeted mutations

Research has shown that several T2S substrates from Xanthomonas campestris pv. vesicatoria were secreted independently of the T2S systems in Xanthomonas campestris pv. campestris, suggesting differences in the T2S substrate specificities between pathovars .

What approaches should I use to distinguish between direct and indirect effects of pefL mutations?

To differentiate direct from indirect effects of pefL mutations:

  • Genetic complementation hierarchy:

    • Create a comprehensive complementation series

    • Test with wild-type gene, point mutations, and truncations

    • Use inducible expression systems to control timing and level

  • Temporal resolution strategies:

    • Implement time-course experiments to establish order of events

    • Use pulse-chase approaches to track protein secretion dynamics

    • Develop conditional mutants for temporal control

  • Biochemical dissection:

    • Perform in vitro reconstitution with purified components

    • Test direct protein-protein interactions with isolated components

    • Develop cell-free secretion assays when possible

  • Multi-omics integration:

    • Combine transcriptomics, proteomics, and metabolomics data

    • Establish causality networks from temporal patterns

    • Identify consistent patterns across multiple data types

  • Pathway validation:

    • Use known inhibitors to block specific steps in hypothesized pathways

    • Create double/triple mutants to establish genetic hierarchies

    • Suppress secondary effects through targeted complementation

This approach allows researchers to build mechanistic models that distinguish primary effects (direct consequences of pefL mutation) from secondary and tertiary effects that propagate through cellular networks .

What are the most promising approaches for studying the structural biology of the Xanthomonas T2S system including pefL?

Cutting-edge structural biology approaches for the T2S system include:

  • Cryo-electron microscopy (Cryo-EM):

    • Single-particle analysis for purified T2S complexes

    • Sub-tomogram averaging for membrane-embedded complexes

    • Time-resolved Cryo-EM to capture secretion intermediates

  • Integrative structural biology:

    • Combine X-ray crystallography of individual components

    • Use NMR for dynamic regions and interactions

    • Implement cross-linking mass spectrometry (XL-MS) to map interaction interfaces

    • Apply molecular dynamics simulations to model complete assemblies

  • In situ structural approaches:

    • Cryo-electron tomography of bacterial cells

    • Correlative light and electron microscopy (CLEM)

    • Super-resolution microscopy with specific labeling strategies

  • Time-resolved methodologies:

    • Implement temperature-jump methods for conformational changes

    • Use microfluidics for rapid mixing experiments

    • Develop optogenetic approaches to trigger assembly/disassembly

  • Structural validation:

    • Create directed mutations based on structural predictions

    • Test function of engineered variants in vivo

    • Implement genetic suppressor screens to validate interaction models

This multi-technique approach will provide unprecedented insights into the assembly, dynamics, and mechanism of the T2S system in Xanthomonas .

How can machine learning approaches enhance our understanding of pefL function and T2S substrate specificity?

Machine learning offers powerful new approaches for T2S system research:

  • Substrate prediction models:

    • Develop algorithms to predict T2S substrates from genomic data

    • Train models using known substrates (xylanases, proteases, lipases)

    • Implement feature extraction from protein sequences, structures, and evolution

    • Validate predictions experimentally with targeted secretion assays

  • Structural prediction enhancement:

    • Apply AlphaFold or RoseTTAFold for modeling pefL and interaction partners

    • Use deep learning to predict protein-protein interaction interfaces

    • Develop models for predicting functional impacts of mutations

  • Experimental design optimization:

    • Implement active learning approaches to guide experimental choices

    • Use Bayesian optimization for efficient parameter tuning

    • Develop experimental design algorithms to maximize information gain

  • Multi-omics data integration:

    • Apply neural networks to integrate diverse data types

    • Implement unsupervised learning for pattern discovery

    • Use generative models to predict system behavior under new conditions

  • Specific ML architecture applications:

    • Graph neural networks for modeling protein interaction networks

    • Recurrent neural networks for temporal secretion dynamics

    • Variational autoencoders for dimensionality reduction of complex datasets

Recent advances in tabular data analysis through multi-representation machine learning approaches could be particularly valuable for analyzing complex datasets from T2S system studies .

What experimental design would best address the potential application of T2S inhibitors as antimicrobial strategies?

A comprehensive experimental design for T2S inhibitor development would include:

  • Target validation phase:

    • Confirm essentiality of pefL for virulence in multiple infection models

    • Identify cross-species conservation to assess spectrum of activity

    • Evaluate potential for resistance development through evolution experiments

  • High-throughput screening design:

    • Develop cell-based reporter assays for T2S function

    • Implement biochemical assays with reconstituted components

    • Design counter-screens to eliminate non-specific compounds

  • Structure-based drug design approach:

    • Identify druggable pockets through computational analysis

    • Perform fragment-based screening against purified proteins

    • Develop structure-activity relationships from initial hits

  • Lead optimization framework:

    • Implement factorial design to optimize multiple parameters simultaneously

    • Use response surface methodology to navigate chemical space efficiently

    • Apply machine learning to guide structural modifications

  • Validation pipeline:

    • Evaluate activity in infection models (cell culture, plant systems)

    • Assess specificity against related bacterial secretion systems

    • Determine mechanism of action through resistant mutant analysis

  • Delivery strategy development:

    • Test formulations for agricultural application

    • Optimize stability under field conditions

    • Develop application protocols to maximize efficacy

This comprehensive approach would systematically identify potential inhibitors of the T2S system that could serve as novel antimicrobial agents for plant protection .

How can I integrate my pefL research with systems biology approaches to understand global virulence networks?

To integrate pefL research within systems biology frameworks:

  • Multi-scale experimental design:

    • Connect molecular mechanisms to cellular phenotypes

    • Link cellular functions to population-level behaviors

    • Relate population dynamics to host-pathogen outcomes

  • Network analysis methodology:

    • Construct protein-protein interaction networks around pefL

    • Develop gene regulatory networks governing T2S expression

    • Create metabolic models impacted by secreted enzymes

    • Integrate networks into unified models

  • Computational modeling approaches:

    • Implement ordinary differential equation models for pathway dynamics

    • Develop agent-based models for bacterial population behaviors

    • Use flux balance analysis to predict metabolic consequences

    • Integrate spatial modeling for infection progression

  • Comparative systems analysis:

    • Extend analysis to multiple Xanthomonas pathovars

    • Compare with other bacterial pathogens using T2S systems

    • Identify conserved and divergent network features

  • Data integration strategy:

    • Implement standard data formats and ontologies

    • Develop databases for T2S system components and functions

    • Create visualization tools for multi-level data integration

This integrated approach allows researchers to position pefL within the broader context of bacterial virulence networks, providing insights into system-level properties that emerge from molecular interactions.

What are the best practices for publishing and sharing Xanthomonas T2S system research data?

Following open science principles is crucial for advancing T2S system research:

  • Data management planning:

    • Create comprehensive data management plans before experiments begin

    • Implement consistent file naming and organization conventions

    • Use electronic lab notebooks with version control

  • Open access publication strategy:

    • Publish in open access journals when possible

    • Consider preprint servers for rapid dissemination

    • Deposit accepted manuscripts in institutional repositories

  • Data sharing best practices:

    • Use domain-specific repositories for specialized data

    • Implement FAIR principles (Findable, Accessible, Interoperable, Reusable)

    • Provide detailed metadata with all deposited datasets

    • Consider data papers for complex datasets

  • Code and protocol sharing:

    • Publish analysis code in repositories like GitHub

    • Use protocol repositories for detailed methodologies

    • Implement container technologies (Docker, Singularity) for computational reproducibility

  • Material sharing considerations:

    • Deposit strains in culture collections

    • Make plasmids available through repositories

    • Develop clear material transfer agreements

  • Collaborative frameworks:

    • Establish research consortia for complex projects

    • Implement shared data standards within the community

    • Develop community guidelines for T2S system research

Following these practices not only improves research reproducibility but also accelerates progress by enabling more effective collaboration within the research community.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.