Recombinant Xanthomonas campestris pv. campestris UPF0060 membrane protein XC_1229 (XC_1229)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional charges apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
XC_1229; UPF0060 membrane protein XC_1229
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-111
Protein Length
full length protein
Species
Xanthomonas campestris pv. campestris (strain 8004)
Target Names
XC_1229
Target Protein Sequence
MSVALTTLLLFVATAVAELVGCYLPYLWLRKGGSVWLLLPAALSLAVFVWLLTLHPAASG RVYAAYGGVYIATALLWLWWVDRVTPTRWDLLGAGCCLLGMAIIMFSPRSG
Uniprot No.

Target Background

Database Links

KEGG: xcb:XC_1229

STRING: 314565.XC_1229

Protein Families
UPF0060 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is known about the basic characteristics of XC_1229 protein?

XC_1229 (also identified as XC229) is a conserved hypothetical protein from Xanthomonas campestris pv. campestris containing 134 amino acids. It shares 40% identity with a protein from Pseudomonas aeruginosa, 29% identity with a protein from Ralstonia solanacearum, and 100% identity with the same protein from X. campestris pv. campestris strain ATCC33913 . The protein has been classified in the putative thioesterase superfamily in the Pfam database, which contains a variety of enzymes including cytosolic long-chain acyl-CoA thioester hydrolases that catalyze the hydrolysis of long-chain fatty acyl-CoA thioesters . The gene sequence consists of 402 base pairs coding for the 134 amino-acid residues.

What structural features have been determined for XC_1229?

The crystal structure of XC_1229 has been studied, with crystals diffracting to a resolution of at least 1.80 Å . The crystal is cubic and belongs to space group I23, with unit-cell parameters a=b=c= 106.8 Å. Interestingly, the protein appears to form stable tetramers that are in equilibrium with the monomer form, even under denaturing conditions used in PAGE analysis . This tetramerization is not due to disulfide bond formation as the protein contains no cysteine residues. Crystals of the recombinant protein grew readily to dimensions of 1.0 × 1.0 × 0.3 mm overnight, making it suitable for detailed X-ray structural analysis .

What are effective methods for recombinant expression of XC_1229?

The recombinant expression of XC_1229 has been successfully achieved in Escherichia coli expression systems. For optimal expression, researchers typically clone the gene sequence into an appropriate expression vector with N-terminal and C-terminal tags for purification purposes . When expressed recombinantly, the protein contains additional amino acids from the tags - for example, in one study, purified XC_1229 contained an extra octapeptide (GSGGGGEF) at the N-terminal end and an octapeptide LEH6 (hexahistidine tag) at the C-terminal end . The addition of these tags did not appear to affect the crystallization process, suggesting they don't significantly disrupt the protein's natural folding.

What purification techniques work best for XC_1229?

While specific purification details aren't fully described in the available literature, the successful purification of XC_1229 has been reported with purity greater than 97%, resulting in a single band of approximately 16.6 kDa on SDS-PAGE (with an additional band at approximately 66 kDa corresponding to the stable tetramer) . For proteins with histidine tags, immobilized metal affinity chromatography (IMAC) is typically employed. When working with full-length proteins that may produce truncated products, using fusion tags on both ends can help distinguish full-length proteins from truncated proteins by increasing the imidazole concentration at elution . Size exclusion chromatography may also be useful to separate the tetrameric and monomeric forms of the protein for specific applications.

How can I determine the three-dimensional structure of XC_1229 using X-ray crystallography?

To determine the structure of XC_1229 using X-ray crystallography, you should follow these methodological steps:

  • Express and purify the recombinant protein as described earlier.

  • Perform crystallization trials using the hanging-drop vapor-diffusion method, which has been successful for this protein .

  • Once suitable crystals are obtained, collect diffraction data.

  • For phase determination, you have two primary options:

    • Multiple isomorphous replacement (MIR) method by preparing platinum or gold heavy-atom derivatives

    • Multiwavelength anomalous diffraction (MAD) method using selenomethionine-substituted protein - particularly suitable for XC_1229 as it contains five methionines

  • Determine heavy-atom positions and phases using automated Patterson analysis.

  • Build and refine the structural model.

For proteins like XC_1229 that form tetramers, consider how oligomerization affects crystal packing and whether the biological unit in the crystal reflects the physiological state of the protein.

What are the challenges in predicting the structure of XC_1229 using computational methods?

Computational prediction of XC_1229's structure presents several challenges:

  • As a hypothetical protein with limited characterized homologs, template-based modeling may be difficult due to low sequence similarity with proteins of known structure.

  • The tetrameric nature of XC_1229 adds complexity to structure prediction, as most prediction algorithms are optimized for monomeric proteins.

  • Predicting the interfaces between monomers in the tetramer requires specialized approaches.

  • Although advances in AI-based protein structure prediction technologies like AlphaFold2 have improved the accuracy of predictions for unknown proteins , multi-domain proteins and protein complexes still present challenges.

To overcome these limitations, a hybrid approach combining homology modeling, molecular dynamics simulations, and experimental validation through techniques like circular dichroism or small-angle X-ray scattering may provide more reliable structural insights when crystallography is not feasible.

What experimental approaches can help determine the enzymatic function of XC_1229?

Given that XC_1229 is classified in the putative thioesterase superfamily, several approaches can help characterize its enzymatic function:

  • Substrate screening: Test activity against a panel of potential thioester substrates, particularly focusing on long-chain fatty acyl-CoA thioesters.

  • Enzymatic assays: Employ spectrophotometric methods to measure thioester bond hydrolysis, such as using 5,5'-dithiobis-(2-nitrobenzoic acid) (DTNB) to detect free thiol groups.

  • Site-directed mutagenesis: Identify and mutate putative catalytic residues based on sequence alignment with characterized thioesterases to confirm their role in catalysis.

  • Metabolomic analysis: Compare the metabolite profiles of wild-type and XC_1229 knockout strains to identify accumulated substrates or depleted products.

  • Protein-protein interaction studies: Identify potential protein partners through co-immunoprecipitation or yeast two-hybrid screens to understand its biological context.

These approaches should be conducted in parallel and the results integrated to build a comprehensive understanding of XC_1229's enzymatic function.

How can I investigate the role of XC_1229 in Xanthomonas campestris pathogenicity?

To investigate the role of XC_1229 in X. campestris pathogenicity, implement the following methodological workflow:

  • Gene knockout/knockdown: Create XC_1229 deletion or silencing mutants using CRISPR-Cas9 or homologous recombination.

  • Complementation studies: Reintroduce the wild-type and mutated versions of XC_1229 to confirm phenotypic changes are due to the specific gene.

  • Virulence assays: Compare the ability of wild-type and mutant strains to infect host plants and assess disease progression.

  • Transcriptomic analysis: Use RNA-Seq to identify genes differentially expressed between wild-type and XC_1229 mutant strains during infection.

  • Metabolite profiling: Examine changes in bacterial or plant metabolites during infection with wild-type versus mutant strains.

  • Localization studies: Use fluorescent protein fusions to determine the subcellular localization of XC_1229 during different stages of infection.

  • Host response analysis: Examine plant defense responses triggered by wild-type versus XC_1229-deficient bacteria.

Integration of these approaches will provide insights into whether XC_1229 plays a direct or indirect role in pathogenicity and its specific mechanisms of action.

What methods are most suitable for identifying interaction partners of XC_1229?

To identify protein interaction partners of XC_1229, consider these methodological approaches:

  • Affinity purification coupled with mass spectrometry (AP-MS): Express tagged XC_1229 in X. campestris, perform pull-down experiments, and identify co-purified proteins by mass spectrometry.

  • Yeast two-hybrid (Y2H) screening: Use XC_1229 as bait to screen against a library of X. campestris proteins.

  • Bacterial two-hybrid (B2H) system: Similar to Y2H but performed in bacterial cells, which may provide a more relevant cellular environment for bacterial proteins.

  • Proximity-dependent biotin identification (BioID): Fuse XC_1229 to a biotin ligase to biotinylate nearby proteins, which can then be isolated and identified.

  • Cross-linking mass spectrometry (XL-MS): Use chemical cross-linkers to capture transient interactions followed by mass spectrometry analysis.

  • Surface plasmon resonance (SPR): Confirm and characterize direct interactions with suspected partners.

For confirmation of interactions discovered through these methods, co-immunoprecipitation studies similar to those demonstrated for other proteins like TSHR and CD40 would be appropriate. These two-way co-IP studies could show that antibodies against XC_1229 pull down both XC_1229 and the interaction partner, and vice versa.

How can the tetrameric structure of XC_1229 influence its interaction network?

The tetrameric structure of XC_1229 may significantly impact its interaction network through several mechanisms:

To experimentally address these possibilities, researchers should:

  • Compare the interactomes of monomeric and tetrameric forms of XC_1229

  • Perform structural studies of XC_1229 in complex with interaction partners

  • Create mutations that disrupt tetramerization to assess how this affects protein interactions and function

What are the advantages of integrating cryo-electron microscopy with X-ray crystallography for studying XC_1229?

Integrating cryo-electron microscopy (cryo-EM) with X-ray crystallography offers several advantages for studying XC_1229:

  • Complementary structural information: While X-ray crystallography provides high-resolution atomic details (1.80 Å for XC_1229 crystals) , cryo-EM can reveal conformational heterogeneity and dynamic regions that might be constrained in crystal structures.

  • Visualization of oligomeric states: Cryo-EM is particularly valuable for studying the tetrameric form of XC_1229 in solution, without crystal packing artifacts.

  • Lower sample requirements: Cryo-EM typically requires less protein material than crystallography, allowing structural studies with difficult-to-express variants.

  • No crystallization requirement: For mutants or complexes that resist crystallization, cryo-EM provides an alternative structural approach.

  • Analysis of conformational dynamics: By capturing multiple conformational states, cryo-EM can provide insights into the protein's dynamic behavior.

A hybrid methodology might involve:

  • Using high-resolution crystallographic data to build atomic models of individual domains

  • Fitting these models into lower-resolution cryo-EM maps of the complete tetramer or protein-protein complexes

  • Validating the integration through molecular dynamics simulations

How can I troubleshoot poor expression of recombinant XC_1229?

Poor expression of recombinant XC_1229 may be addressed through these methodological steps:

  • Codon optimization: Analyze the gene sequence for rare codons in the expression host and synthesize a codon-optimized version, as proteins containing multiple rare codons linked together may cause expression difficulties .

  • Expression vector selection: Test different expression vectors with various promoters (T7, tac, etc.) and fusion tags (His, GST, MBP, SUMO) to find the optimal combination.

  • Host strain selection: Screen multiple E. coli strains including BL21(DE3), Rosetta (for rare codons), or C41/C43 (for potentially toxic proteins).

  • Expression conditions optimization:

    • Test different induction temperatures (16°C, 25°C, 37°C)

    • Vary IPTG concentrations (0.1-1.0 mM)

    • Adjust induction timing (early vs. late log phase)

    • Try different media formulations (LB, TB, auto-induction)

  • Solubility enhancement: Include solubility-enhancing additives in the lysis buffer such as detergents, glycerol, or arginine.

  • Lysis method evaluation: Compare sonication, French press, and chemical lysis to identify the most effective method for XC_1229.

For transmembrane or highly hydrophobic proteins like some UPF0060 family members, specialized approaches such as the MNP platform that extracts high-purity nanoscale cell membrane particles while maintaining membrane protein conformation may be required .

What strategies can resolve the issue of obtaining truncated XC_1229 products?

When facing issues with truncated XC_1229 products, implement the following methodological approaches:

  • Dual tagging strategy: Express XC_1229 with fusion tags on both N and C termini (as demonstrated in the reported study with N-terminal GSGGGGEF and C-terminal LEH6 tags) to distinguish full-length proteins from truncated products during purification.

  • Increased imidazole concentration: During elution from IMAC columns, gradually increase the imidazole concentration to separate truncated products from full-length protein .

  • Protease inhibitor cocktail: Include a comprehensive protease inhibitor cocktail during cell lysis and throughout the purification process to minimize proteolytic degradation.

  • Expression temperature reduction: Lower the expression temperature to 16-20°C to slow down protein synthesis and allow more time for proper folding, potentially reducing proteolysis of misfolded proteins.

  • mRNA secondary structure analysis: Examine the mRNA sequence for secondary structures that might cause ribosomal pausing and premature translation termination, and modify these regions through silent mutations.

  • Western blot analysis: Use antibodies against both N and C-terminal tags to identify at which end truncation is occurring, providing clues about the mechanism.

For confirmation of full-length protein, SDS-PAGE analysis under conditions that disrupt the tetrameric form (such as heating at 363 K for 5 minutes before loading) can be used to verify the expected monomeric molecular weight of approximately 16.6 kDa .

How can I distinguish between physiological and crystallization-induced oligomeric states of XC_1229?

Distinguishing between physiological and crystallization-induced oligomeric states requires a multi-technique approach:

  • Size exclusion chromatography (SEC): Analyze the elution profile of XC_1229 under physiological buffer conditions to determine the predominant oligomeric state in solution.

  • SEC-MALS (Multi-angle light scattering): Combine SEC with MALS to accurately determine the absolute molecular weight of oligomers in solution.

  • Analytical ultracentrifugation (AUC): Perform sedimentation velocity and equilibrium experiments to characterize the oligomerization state and measure the dissociation constant.

  • Native mass spectrometry: Analyze the intact protein complexes to determine oligomeric states while preserving non-covalent interactions.

  • Cross-linking experiments: Use chemical cross-linkers of various lengths to capture the oligomeric states in solution before analysis by SDS-PAGE.

  • SAXS (Small-angle X-ray scattering): Obtain low-resolution structural information about the shape and size of XC_1229 oligomers in solution.

  • Structure-based mutagenesis: Identify interface residues from the crystal structure and mutate them to disrupt potential oligomerization surfaces, then assess the impact on oligomerization in solution.

The observation that XC_1229 forms a stable tetramer that persists even under the denaturing conditions of SDS-PAGE suggests that this tetrameric form is likely physiologically relevant rather than a crystallization artifact .

What are the best approaches for solving the phase problem in XC_1229 crystallography when molecular replacement is not an option?

When molecular replacement is not viable for XC_1229 crystallography, consider these experimental phasing approaches:

  • Selenomethionine (SeMet) labeling for MAD/SAD: Since XC_1229 contains five methionines, expression in minimal media with SeMet instead of methionine will incorporate selenium atoms at specific positions, enabling multiwavelength anomalous diffraction (MAD) or single-wavelength anomalous diffraction (SAD) phasing . The protocol involves:

    • Growing E. coli in minimal media and adding amino acids including SeMet before induction

    • Confirming incorporation by mass spectrometry

    • Collecting diffraction data at multiple wavelengths around the selenium absorption edge

  • Heavy atom derivatives for MIR/SIRAS: Prepare isomorphous heavy atom derivatives by soaking crystals in solutions containing heavy atoms like platinum or gold . This approach requires:

    • Screening various heavy atom compounds (e.g., K2PtCl4, KAu(CN)2)

    • Optimizing soaking conditions (concentration and duration)

    • Collecting diffraction data from native and derivative crystals

    • Determining heavy atom positions using automated Patterson analysis as described by Terwilliger & Berendzen

  • Sulfur-SAD phasing: Exploit the anomalous signal from native sulfur atoms (from methionines and cysteines) by collecting highly redundant data at longer wavelengths.

  • Combining techniques: Use a hybrid approach combining partial molecular replacement from distantly related structures with experimental phasing to improve phase estimates.

How can comparative genomics inform our understanding of XC_1229 function across bacterial species?

Comparative genomics provides valuable insights into XC_1229 function through these methodological approaches:

  • Ortholog identification and analysis: Identify XC_1229 orthologs across bacterial species (such as the known orthologs in Pseudomonas aeruginosa with 40% identity and Ralstonia solanacearum with 29% identity) and analyze:

    • Sequence conservation patterns

    • Co-occurrence with specific metabolic pathways

    • Genomic context and operon structure

    • Residue conservation at putative active sites

  • Phylogenetic profiling: Construct phylogenetic trees of XC_1229 orthologs to:

    • Trace the evolutionary history of the protein

    • Identify potential horizontal gene transfer events

    • Correlate protein presence with specific bacterial lifestyles or habitats

  • Synteny analysis: Examine the conservation of gene order around XC_1229 across species to identify consistently co-located genes that might be functionally related.

  • Mutation rate analysis: Calculate the ratio of non-synonymous to synonymous substitutions (dN/dS) to identify regions under selective pressure, suggesting functional importance.

  • Domain architecture comparison: Analyze whether XC_1229 orthologs maintain the same domain structure across species or have gained/lost domains.

Integration of these computational approaches with experimental validation in diverse bacterial species can reveal conserved functions and species-specific adaptations of this hypothetical protein family.

What evolutionary insights can be gained from studying XC_1229 and its homologs?

Studying XC_1229 and its homologs provides several evolutionary insights:

  • Protein family evolution: The classification of XC_1229 in the putative thioesterase superfamily allows investigation of how this protein family diversified across bacterial lineages:

    • When did specialization of different thioesterase subfamilies occur?

    • How do bacterial thioesterases relate to eukaryotic counterparts?

  • Functional adaptation: By comparing XC_1229 across plant pathogenic, animal pathogenic, and non-pathogenic bacteria:

    • Identify adaptations specific to plant pathogenesis

    • Determine if the protein has been repurposed for different functions in different bacterial lifestyles

  • Horizontal gene transfer assessment: Analyze phylogenetic incongruences to detect potential horizontal gene transfer events:

    • Do certain bacteria possess XC_1229 homologs that are more similar to distant rather than close relatives?

    • Is the distribution of this gene family consistent with vertical inheritance or does it suggest lateral transfers?

  • Structural conservation versus sequence divergence: Compare the degree of structural conservation relative to sequence conservation:

    • Do distantly related homologs maintain similar tertiary structures despite sequence divergence?

    • Which structural elements are most conserved, suggesting functional importance?

  • Host-pathogen co-evolution: For pathogenic species, determine if XC_1229 shows signatures of co-evolution with host defense mechanisms.

How might structural information about XC_1229 inform antibacterial drug development?

Structural information about XC_1229 can inform antibacterial drug development through these methodological strategies:

  • Structure-based drug design: If XC_1229 proves essential for bacterial viability or virulence, its high-resolution crystal structure (1.80 Å) provides an excellent foundation for:

    • Identifying druggable pockets through computational solvent mapping

    • Virtual screening of chemical libraries against these pockets

    • Fragment-based drug discovery approaches

    • Structure-guided optimization of hit compounds

  • Targeting bacterial-specific features: Since XC_1229 is a bacterial protein without close human homologs, target:

    • Unique structural features absent in human proteins

    • The oligomerization interface of the tetramer , potentially disrupting essential protein-protein interactions

    • Binding sites that may be involved in thioesterase activity, if confirmed

  • Exploiting conformational dynamics: Use molecular dynamics simulations based on the crystal structure to:

    • Identify transient binding pockets not visible in static structures

    • Understand allosteric communication networks within the protein

    • Design allosteric inhibitors that lock the protein in inactive conformations

  • Broad-spectrum potential assessment: Compare structures of XC_1229 homologs from different pathogens to:

    • Identify conserved pockets for broad-spectrum inhibitor development

    • Design selective inhibitors for specific bacterial species

    • Create hybrid molecules that target conserved and variable regions

  • Rational design of transition-state analogs: If enzymatic activity is confirmed, design inhibitors that mimic the transition state of the reaction catalyzed by XC_1229.

These structure-guided approaches can accelerate the development of new antibacterials against Xanthomonas and potentially other plant or human pathogens containing XC_1229 homologs.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.