The Xanthomonas campestris pv. campestris UPF0060 membrane protein xcc-b100_1273 (xcc-b100_1273) is a protein associated with the bacterium Xanthomonas campestris pv. campestris . Xanthomonas campestris is a bacterial species known to infect a wide range of Brassicaceae (cruciferous plants), causing diseases such as black rot in crucifers . The xcc-b100_1273 protein is annotated as a UPF0060 membrane protein, with UPF0060 being a protein family of unknown function . Recombinant forms of this protein are produced for research purposes, often using E. coli as the expression host .
While the precise function of xcc-b100_1273 is not yet known, it is presumed to be a membrane protein. Membrane proteins are crucial for various cellular processes, including transport, signaling, and maintaining cell structure. In Xanthomonas, outer membrane proteins and outer membrane vesicles (OMVs) are known to be associated with virulence . OMVs contain membrane- and virulence-associated proteins and may serve as vehicles for transporting virulence factors into the host membrane .
Recombinant xcc-b100_1273 is produced using E. coli as an expression system . The protein is expressed as a full-length protein (1-111 amino acids) with an N-terminal His tag to facilitate purification using affinity chromatography . The recombinant protein is typically provided as a lyophilized powder .
Recombinant xcc-b100_1273 can be utilized in several research applications:
Antibody Production: Recombinant proteins can be used as antigens to generate antibodies for protein detection and localization studies.
Protein Interaction Studies: The protein can be used in pull-down assays or other interaction studies to identify binding partners and elucidate its function.
Structural Studies: Recombinant production is the first step towards protein crystallization and solving its 3D structure, which can provide insights into its function.
Xanthomonas campestris utilizes various mechanisms to infect plants, including the type II secretion system (T2S) and outer membrane vesicles . The T2S system secretes degradative enzymes that break down plant cell walls, promoting virulence . Proteins can also be secreted via outer membrane vesicles . Understanding the secretion pathways and virulence factors of Xanthomonas is crucial for developing strategies to control bacterial diseases in plants .
KEGG: xca:xcc-b100_1273
The xcc-b100_1273 protein is a full-length (1-111 amino acids) membrane protein from Xanthomonas campestris pv. campestris. The amino acid sequence is similar to the related XC_1229 protein which has the sequence: MSVALTTLLLFVATAVAELVGCYLPYLWLRKGGSVWLLLPAALSLAVFVWLLTLHPAASGRVYAAYGGVYIATALLWLWWVDRVTPTRWDLLGAGCCLLGMAIIMFSPRSG . As a UPF0060 family membrane protein, it contains hydrophobic regions consistent with transmembrane domains, including characteristic membrane-spanning helices that integrate into bacterial cell membranes. The protein likely adopts a folding pattern typical of bacterial membrane proteins with multiple transmembrane segments anchored in the lipid bilayer. Structural analysis using prediction tools suggests the presence of alpha-helical transmembrane domains interspersed with loop regions that may be involved in functional interactions or substrate binding.
The xcc-b100_1273 protein belongs to the UPF0060 family of membrane proteins that are widely distributed across bacterial species but remain functionally uncharacterized (hence the "UPF" or "Uncharacterized Protein Family" designation) . Sequence alignment with other UPF0060 family proteins reveals conserved motifs, particularly in the transmembrane regions, suggesting evolutionary conservation of structure-function relationships. Comparative analysis with the related XC_1229 protein shows high sequence similarity, indicating they likely share functional properties . While the exact function remains to be fully elucidated, the conservation across bacterial species suggests biological significance. The protein size (111 amino acids) is consistent with other members of this family, which typically range from 100-120 amino acids with multiple predicted transmembrane domains.
Recombinant xcc-b100_1273 protein can be successfully expressed in several heterologous systems, with E. coli being the most commonly used platform due to its efficiency and scalability . When expressing this membrane protein, specialized E. coli strains such as BL21(DE3), Rosetta-GAMI, and others may be employed to address the challenges of membrane protein expression . Alternative expression systems include yeast (such as SMD1168, GS115, X-33), insect cell lines (Sf 9, Sf 21, Sf High Five), and mammalian cell lines (293, 293T, CHO) for cases where bacterial expression does not yield properly folded protein . Each expression system offers different advantages in terms of post-translational modifications, protein folding, and yield. The choice of expression system should be guided by the intended application and the requirement for native-like protein structure.
For optimal expression of recombinant xcc-b100_1273 in E. coli, several critical parameters require careful optimization. Temperature control is essential, with induction typically performed at lower temperatures (16-25°C) to slow protein production and enhance proper folding of this membrane protein. The selection of an appropriate E. coli strain is crucial, with BL21(DE3) commonly used for initial trials, though strains designed for membrane proteins or those containing rare codons (such as Rosetta-GAMI) may improve yields significantly . Induction conditions should be optimized by testing various IPTG concentrations (typically 0.1-1.0 mM) and induction times (4-24 hours). For optimal results, specialized media formulations that support membrane protein expression, such as Terrific Broth supplemented with glycerol, may provide superior results compared to standard LB media. Additionally, inclusion of specific additives such as glucose (to prevent leaky expression) or mild detergents (to assist in membrane protein folding) can significantly enhance expression levels and protein quality.
Purification of recombinant xcc-b100_1273 typically employs a multi-step approach beginning with affinity chromatography utilizing the His-tag present in most recombinant constructs . The initial step involves cell lysis using methods optimized for membrane proteins, such as sonication or pressure-based disruption in the presence of appropriate detergents (e.g., n-dodecyl-β-D-maltoside or CHAPS) to solubilize the membrane fraction. Following lysis, immobilized metal affinity chromatography (IMAC) using Ni-NTA or similar resins captures the His-tagged protein, with careful optimization of imidazole concentrations in wash and elution buffers to maximize purity. Secondary purification steps typically include size exclusion chromatography (SEC) to separate monomeric protein from aggregates and remove remaining contaminants. For applications requiring exceptionally high purity, ion exchange chromatography may serve as a tertiary purification step. Throughout the purification process, maintaining an appropriate detergent concentration above the critical micelle concentration is essential to prevent protein aggregation. Final quality assessment should include SDS-PAGE analysis, with expected purity exceeding 90% for most research applications .
Maintaining the structural integrity and activity of purified recombinant xcc-b100_1273 requires careful attention to storage conditions. For short-term storage (up to one week), the protein should be maintained at 4°C in an appropriate buffer system containing the stabilizing detergent used during purification . For long-term storage, the protein should be flash-frozen in liquid nitrogen and stored at -80°C in single-use aliquots to avoid repeated freeze-thaw cycles, which can significantly reduce protein activity and promote aggregation . The storage buffer should contain cryoprotectants such as glycerol (typically 20-50%) or trehalose (around 6%), which help maintain protein structure during freezing . The pH of the storage buffer should be optimized, with Tris/PBS-based buffers at pH 8.0 typically providing good stability for this protein . For applications requiring lyophilization, the protein can be freeze-dried in the presence of appropriate lyoprotectants and subsequently reconstituted in sterile deionized water to a concentration of 0.1-1.0 mg/mL . Quality control testing should be performed after extended storage periods to confirm retention of structural integrity and functional activity.
Elucidating the function of xcc-b100_1273 requires a multi-faceted experimental approach that integrates genomic context analysis, structural characterization, and functional assays. Comparative genomics represents a valuable starting point, analyzing the genomic neighborhood of xcc-b100_1273 to identify potential functional associations with operons or gene clusters involved in specific bacterial processes . Structural characterization through techniques such as X-ray crystallography, cryo-electron microscopy, or NMR spectroscopy can provide insights into the three-dimensional arrangement and potential binding sites. Protein-protein interaction studies using pull-down assays, yeast two-hybrid systems, or crosslinking approaches can identify binding partners that may suggest functional roles. Phenotypic characterization of knockout mutants, comparing growth, morphology, stress resistance, and virulence between wild-type and Δxcc-b100_1273 strains, can reveal physiological functions. Complementation studies should be conducted to confirm that observed phenotypes are specifically attributable to the absence of xcc-b100_1273. For membrane proteins like xcc-b100_1273, transport assays using reconstituted proteoliposomes or whole-cell uptake experiments with labeled substrates may uncover potential transporter activity.
Investigating the three-dimensional structure of xcc-b100_1273 requires specialized approaches tailored to membrane proteins. X-ray crystallography remains a powerful technique, though it necessitates generating highly pure, homogeneous, and stable protein preparations, often requiring extensive screening of detergents, lipids, and crystallization conditions to identify those that support crystal formation . Single-particle cryo-electron microscopy offers significant advantages for membrane proteins by eliminating the crystallization requirement, instead visualizing the protein in a more native-like environment within detergent micelles, nanodiscs, or liposomes. Solution NMR spectroscopy, while challenging for larger membrane proteins, can provide valuable dynamic information and is particularly useful for studying smaller domains or loops of xcc-b100_1273. Solid-state NMR spectroscopy can analyze membrane proteins reconstituted into lipid bilayers, providing structural insights in a near-native environment. Hydrogen-deuterium exchange mass spectrometry combined with computational modeling can provide medium-resolution structural information about secondary structure elements and their solvent accessibility. For all these methods, protein engineering approaches—such as thermostabilizing mutations, fusion partners to enhance solubility, or antibody fragment co-crystallization—may be necessary to obtain suitable samples for structural studies. Computational approaches including homology modeling and molecular dynamics simulations can complement experimental data, particularly when based on structures of related UPF0060 family proteins.
Investigating protein-protein interactions involving xcc-b100_1273 requires specialized approaches suitable for membrane proteins. Co-immunoprecipitation using antibodies against xcc-b100_1273 or its tagged version can identify interaction partners from bacterial lysates, though care must be taken to use detergents that maintain protein-protein interactions while solubilizing membrane complexes . Crosslinking approaches, particularly using membrane-permeable crosslinkers with various spacer lengths, can capture transient or weak interactions before solubilization. Bacterial two-hybrid systems specifically designed for membrane proteins offer an in vivo approach to detect interactions in a cellular context. For more quantitative analysis, surface plasmon resonance or biolayer interferometry can determine binding kinetics between purified xcc-b100_1273 and potential partners. Mass spectrometry-based approaches such as proximity-dependent biotin identification (BioID) or APEX2 proximity labeling can identify proteins in close proximity to xcc-b100_1273 within the native cellular environment. Fluorescence techniques, including Förster resonance energy transfer (FRET) or bimolecular fluorescence complementation (BiFC), enable visualization of interactions in living bacteria. Analytical ultracentrifugation and size exclusion chromatography combined with multi-angle light scattering can characterize the stoichiometry and stability of purified protein complexes. When designing these experiments, both positive controls (known interacting pairs) and negative controls (proteins unlikely to interact with membrane proteins) should be included to validate the experimental system.
Functional genomics approaches provide powerful tools for understanding xcc-b100_1273's role in bacterial physiology through system-wide analysis. Transcriptomic profiling using RNA-seq comparing wild-type and Δxcc-b100_1273 strains under various conditions (e.g., different growth phases, stress conditions, plant infection) can reveal genes and pathways affected by the absence of this protein . Proteomics approaches, particularly quantitative techniques such as iTRAQ or TMT labeling, can identify changes in protein abundance or post-translational modifications resulting from xcc-b100_1273 deletion. Metabolomic analysis can detect alterations in metabolite profiles that might indicate the biochemical pathways influenced by this membrane protein. ChIP-seq or similar techniques could be employed if xcc-b100_1273, despite being a membrane protein, is hypothesized to have any role in regulating gene expression. Genome-wide genetic interaction screens, such as synthetic genetic array analysis or transposon sequencing (Tn-seq), can identify genes that show synthetic lethality or synthetic rescue effects when mutated in combination with xcc-b100_1273 deletion, providing insights into functional relationships. Phenotypic microarrays testing growth under hundreds of different conditions can reveal specific environments or stressors where xcc-b100_1273 becomes particularly important. Integration of these multiple omics datasets using systems biology approaches and network analysis can provide a comprehensive understanding of xcc-b100_1273's role in cellular processes, potentially revealing unexpected functions beyond what might be predicted from sequence analysis alone.
Recombinant expression of membrane proteins like xcc-b100_1273 presents several common challenges that researchers must systematically address. Protein toxicity during expression frequently occurs when membrane proteins accumulate in host cells, disrupting membrane integrity and cellular processes. This can be mitigated by using tightly controlled inducible promoters, lowering induction temperatures (16-20°C), reducing inducer concentration, or using specialized E. coli strains designed to tolerate membrane protein overexpression . Protein misfolding and aggregation often result in inclusion body formation, requiring refolding strategies or alternative approaches such as expressing the protein as a fusion with solubilizing partners like MBP or SUMO . Codon usage differences between Xanthomonas and expression hosts can limit translation efficiency, necessitating codon optimization of the synthetic gene or using hosts with rare tRNA supplementation . Low yield issues can be addressed through systematic optimization of growth media composition, induction timing, and harvest points. For proper membrane protein insertion, expression hosts with intact membrane protein insertion machinery should be selected, possibly supplementing growth media with phospholipids that match the native membrane composition of Xanthomonas. Post-expression analysis should include Western blotting to confirm expression and membrane fractionation to verify proper localization.
Troubleshooting purification problems with xcc-b100_1273 requires systematic analysis and optimization of multiple parameters throughout the purification workflow. Poor solubilization is a common initial challenge, necessitating screening of various detergents (ranging from harsh ionic detergents like SDS to milder non-ionic detergents like DDM or LMNG) at different concentrations to identify optimal extraction conditions without denaturing the protein . Low binding to affinity resins may occur if the affinity tag is obscured within detergent micelles; this can be addressed by repositioning the tag from N-terminus to C-terminus or vice versa, using longer linker sequences between the tag and protein, or trying alternative affinity systems beyond the standard His-tag . Co-purification of contaminants often occurs with membrane proteins and can be addressed by incorporating additional washing steps with higher salt concentrations or low concentrations of secondary detergents. Protein precipitation during purification frequently results from detergent depletion below critical micelle concentration and can be prevented by maintaining consistent detergent concentrations in all buffers. Protein instability during storage may require screening of stabilizing additives such as specific lipids, cholesterol hemisuccinate, or glycerol . For difficult-to-purify constructs, alternative approaches such as purification under denaturing conditions followed by controlled refolding, or the use of SMALPs (styrene-maleic acid lipid particles) to extract the protein with its native lipid environment, may prove successful when conventional approaches fail.
When confronted with contradictory experimental data regarding xcc-b100_1273 function, researchers should implement a systematic approach to resolve discrepancies. Begin with a comprehensive experimental design review, examining whether different methodologies, experimental conditions, or genetic backgrounds might explain contradictory results . Standardize experimental protocols across different research groups by developing detailed standard operating procedures (SOPs) that specify bacterial strains, growth conditions, protein preparation methods, and assay parameters in minute detail. Consider context-dependent protein function, as membrane proteins may display different activities under various environmental conditions or growth phases; design experiments that directly test whether function varies across contexts. Examine potential post-translational modifications or alternate splicing that might yield protein variants with distinct functions. Investigate oligomerization states, as many membrane proteins function differently as monomers versus oligomers, potentially explaining divergent functional observations. Validate antibody specificity through appropriate controls to ensure observed signals genuinely represent xcc-b100_1273. Perform epistasis analysis to position xcc-b100_1273 within known pathways, helping to reconcile apparently contradictory phenotypic observations. Consider redundant systems, as bacteria often possess compensatory mechanisms that may mask phenotypes in single-gene deletion studies. Implement blinded experimental designs and inter-laboratory validation studies to minimize unconscious experimenter bias. Finally, develop quantitative models that might accommodate seemingly contradictory data within a unified theoretical framework that explains how the protein's function varies under different experimental conditions.
Future research on xcc-b100_1273 shows considerable promise in several key directions that could significantly advance our understanding of this membrane protein. High-resolution structural studies using cryo-electron microscopy or X-ray crystallography would provide crucial insights into the protein's three-dimensional architecture and potential functional sites, possibly revealing unexpected structural features not predictable from sequence analysis alone . Systematic mutagenesis studies targeting conserved residues across UPF0060 family members could identify amino acids essential for function, providing clues about biochemical mechanisms. Comparative studies across different Xanthomonas species and pathovars could reveal evolutionary patterns and potential host-specific adaptations in protein function. Development of specific inhibitors or modulators of xcc-b100_1273 activity might provide new tools for investigating bacterial pathogenesis and potentially lead to novel antimicrobial strategies. Interactome mapping using advanced proteomics approaches could position xcc-b100_1273 within cellular protein networks, helping to infer function from its interaction partners. Investigation of potential roles in bacterial communication, biofilm formation, or host interaction could reveal unexpected functions beyond basic membrane processes. Technological innovations such as in-cell structural studies or advanced imaging techniques may allow visualization of xcc-b100_1273 during actual infection processes, providing dynamic functional information. Multi-disciplinary approaches integrating structural biology, genetics, biochemistry, and plant pathology will likely be necessary to fully elucidate the biological significance of this intriguing membrane protein.
The research community would benefit significantly from adopting standardized protocols for xcc-b100_1273 characterization, enabling more reliable cross-laboratory comparisons and accelerating scientific progress. Expression and purification protocols should be harmonized, specifying bacterial strains, vector designs, culture conditions, induction parameters, and detailed purification steps to ensure consistent protein preparations . Analytical quality control standards should include minimum purity thresholds (typically >90% by SDS-PAGE), validated by mass spectrometry to confirm protein identity and integrity, alongside biophysical characterization using circular dichroism or other techniques to verify proper folding . Functional assay standardization should encompass detailed protocols for activity measurements, with clearly defined buffer compositions, temperature conditions, and data analysis methods. Phenotypic characterization of deletion mutants should follow consistent methodologies for creating gene deletions, complementation strategies, and quantitative phenotype assessment. Structural biology approaches should adopt common reconstitution methods specifying detergent types, concentrations, and lipid compositions for maintaining native-like protein environments. Interaction studies should implement standardized control experiments and statistical thresholds for determining significant interactions. Data reporting standards should include complete methodology descriptions and raw data deposition in public databases. Reference materials, such as validated antibodies and well-characterized protein preparations, should be established and shared. Collaborative validation studies involving multiple laboratories could verify key findings using these standardized protocols, strengthening the foundation of knowledge about this important bacterial membrane protein.