Recombinant Xanthomonas campestris pv. campestris UPF0060 membrane protein XCC2880 (XCC2880)

Shipped with Ice Packs
In Stock

Description

General Information

Xanthomonas campestris pv. campestris ( Xcc) is a vascular pathogen that enters plants through hydathodes, natural openings on leaves . Understanding how pathogens thrive during host colonization, especially in these early infection stages, is crucial for developing effective disease control strategies .

Identification of Fitness Determinants

A study utilizing randomly barcoded transposon insertion site sequencing (RB-TnSeq) identified 181 genes important for fitness in plant-associated environments, with a focus on genes involved in metabolism . XCC2880, also known as XC_3388, emerged as a significant protein with no previously known function, playing a crucial role in the adaptation and virulence of Xcc .

Role in Virulence and Adaptation

Research indicates that XCC2880 potentially influences virulence through c-di-GMP-mediated regulation .

Protein Structure

Proteins are composed of amino acids linked together in a specific sequence, which determines the protein's primary structure . This sequence dictates the three-dimensional conformation that the folded protein will adopt, which in turn determines its function .

The secondary structure of proteins involves the spatial arrangement of amino acids that are close to each other in the sequence . Common secondary structures include alpha-helices and beta-pleated sheets . Alpha-helices are coiled structures stabilized by hydrogen bonds between the C=O and N-H groups in the polypeptide backbone .

Coiled coils represent a structural motif found in proteins, where 2-7 alpha-helices coil together like strands of a rope . These coiled coils typically contain a repeating pattern of hydrophobic and charged amino acid residues, facilitating their assembly and stability .

Outer Membrane Vesicles (OMVs)

Xanthomonas campestris pv. campestris releases outer membrane vesicles (OMVs) into the culture supernatant during growth . These vesicles contain membrane and virulence-associated proteins, suggesting their potential role in transporting virulence factors into the host membrane .

Data Table: Key Findings on XCC2880

FeatureDescription
Protein NameRecombinant Xanthomonas campestris pv. campestris UPF0060 membrane protein XCC2880
Alternate NameXC_3388
FunctionProtein of unknown function (DUF1631); plays a key role in the adaptation and virulence of Xcc
Role in VirulencePossibly through c-di-GMP-mediated regulation
SignificanceFitness determinant during early stages of plant infection
Bacterial SpeciesXanthomonas campestris pv. campestris (Xcc)
Host PlantBrassica oleracea (cauliflower)
Location during InfectionHydathodes (natural entry site of Xcc)
Method of IdentificationRandomly barcoded transposon insertion site sequencing (RB-TnSeq)

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order remarks. We will accommodate your request whenever possible.
Lead Time
Delivery times vary depending on purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C; lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during production. If you require a particular tag, please inform us, and we will prioritize its use.
Synonyms
XCC2880; UPF0060 membrane protein XCC2880
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-111
Protein Length
full length protein
Species
Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
Target Names
XCC2880
Target Protein Sequence
MSVALTTLLLFVATAVAELVGCYLPYLWLRKGGSVWLLLPAALSLAVFVWLLTLHPAASG RVYAAYGGVYIATALLWLWWVDRVTPTRWDLLGAGCCLLGMAIIMFSPRSG
Uniprot No.

Target Background

Database Links

KEGG: xcc:XCC2880

STRING: 190485.XCC2880

Protein Families
UPF0060 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is XCC2880 and what organism does it originate from?

XCC2880 is a UPF0060 family membrane protein from Xanthomonas campestris pv. campestris strain ATCC 33913, a Gram-negative bacterium that causes black rot disease in cruciferous plants, including important vegetable Brassica crops . The UPF0060 designation indicates it belongs to an uncharacterized protein family, meaning its precise biological function has not been fully determined. The protein consists of 111 amino acids and is integrated into the bacterial membrane .

Xanthomonas campestris pv. campestris belongs to:

  • Domain: Bacteria

  • Phylum: Pseudomonadota

  • Class: Gammaproteobacteria

  • Order: Xanthomonadales

  • Family: Xanthomonadaceae

  • Genus: Xanthomonas

  • Species: X. campestris

How is recombinant XCC2880 typically expressed and purified for research purposes?

Recombinant XCC2880 is typically expressed in E. coli expression systems with an N-terminal His-tag to facilitate purification . The standard expression protocol includes:

  • Cloning the full-length gene (1-111 amino acids) into an expression vector with an N-terminal His-tag

  • Transforming the construct into E. coli

  • Inducing protein expression (likely using IPTG, though specific conditions aren't detailed in the search results)

  • Cell lysis and membrane protein extraction

  • Purification using affinity chromatography (His-tag binding to Ni-NTA or similar resin)

  • Further purification steps as needed (e.g., size exclusion chromatography)

The purified protein is typically supplied as a lyophilized powder with greater than 90% purity as determined by SDS-PAGE . For storage, the protein is often provided in a Tris/PBS-based buffer with 6% trehalose at pH 8.0 .

What are the optimal conditions for reconstituting and storing recombinant XCC2880?

For optimal reconstitution and storage of recombinant XCC2880, follow these research-validated protocols:

  • Reconstitution procedure:

    • Briefly centrifuge the vial prior to opening to bring the contents to the bottom

    • Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

    • Add glycerol to a final concentration of 5-50% (50% is recommended as default)

    • Aliquot for long-term storage

  • Storage conditions:

    • Store at -20°C/-80°C upon receipt

    • Aliquoting is necessary for multiple use to avoid repeated freeze-thaw cycles

    • Working aliquots can be stored at 4°C for up to one week

    • Repeated freezing and thawing is not recommended

These conditions are optimized based on experimental determination of protein stability. The addition of trehalose (6%) in the storage buffer helps maintain protein structure during freeze-thaw cycles by preventing denaturation.

How can XCC2880 be studied in its native membrane environment?

Recent advances in membrane protein research provide methods to study proteins like XCC2880 in their native membrane environment, avoiding the destabilization often caused by detergent extraction. Two particularly valuable approaches are:

  • Total cell membrane vesicle isolation:

    • Isolate membranes from cells expressing the protein of interest

    • Homogenize and sonicate to form small unilamellar vesicles (SUVs)

    • Enrich for the protein using affinity purification

    • Use the membrane vesicles for structural or functional studies

  • Plasma membrane vesicle isolation:

    • Treat cells with N-ethylmaleimide (NEM) in the presence of Ca²⁺ to generate giant plasma membrane vesicles (GPMVs)

    • Sonicate to form SUVs

    • Enrich using affinity purification (e.g., with nanobody resin)

These methods preserve the native lipid environment and weakly associated cofactors or interacting proteins. For XCC2880, these approaches could be particularly valuable since membrane proteins often require specific lipid environments for proper function and folding. Cryo-EM analysis of these membrane-embedded preparations can achieve resolutions comparable to or better than detergent-solubilized samples, reaching 2.7-3.8 Å in optimal cases .

How does XCC2880 compare to other UPF0060 family proteins?

XCC2880 belongs to the UPF0060 family of membrane proteins, which are found across various bacterial species. Comparative analysis reveals:

For a more comprehensive comparison, researchers could perform sequence alignments and structural superpositions of XCC2880 with other UPF0060 family members to identify conserved regions that might indicate functional importance.

What potential role might XCC2880 play in Xanthomonas campestris pathogenicity?

The role of XCC2880 in X. campestris pathogenicity has not been directly established in the provided search results, but several lines of evidence suggest possible functions:

  • Membrane localization: As a membrane protein, XCC2880 could potentially be involved in:

    • Transport of nutrients or virulence factors

    • Sensing environmental signals in the plant host

    • Cell envelope integrity during infection

  • Context within Xcc pathogenicity factors: Xcc pathogenicity involves several gene systems:

    • Avirulence (avr) genes

    • Hypersensitivity response and pathogenicity (hrp) genes

    • Pathogenicity factors (rpf) genes

    • Extracellular enzymes and polysaccharides

  • Comparative genomic insights: Genome-wide fitness determinant studies have identified genes important for Xcc survival in plant-associated environments. While XCC2880 is not specifically mentioned, similar membrane proteins may contribute to adaptation to the plant environment .

To determine if XCC2880 plays a role in pathogenicity, researchers could employ the following experimental approaches:

  • Generate knockout mutants and assess virulence on host plants

  • Perform transcriptomic analysis to determine if XCC2880 expression changes during infection

  • Use transposon-sequencing (Tn-seq) to evaluate fitness contribution in planta

What experimental approaches can be used to determine the function of XCC2880?

To determine the function of this uncharacterized membrane protein, several complementary approaches can be employed:

  • Gene knockout and complementation studies:

    • Generate an XCC2880 deletion mutant in X. campestris

    • Assess phenotypic changes in growth, stress response, and virulence

    • Perform complementation with wild-type gene to confirm phenotype is due to the deletion

    • This approach has been successfully used to characterize other Xcc proteins

  • Protein localization and topology mapping:

    • Use GFP fusion proteins to determine subcellular localization

    • Apply protease accessibility assays to map the membrane topology

    • Perform immunogold electron microscopy to visualize precise membrane localization

  • Protein-protein interaction studies:

    • Bacterial two-hybrid screening

    • Co-immunoprecipitation with tagged XCC2880

    • Crosslinking mass spectrometry to identify neighboring proteins in the membrane

  • Structural analysis:

    • Utilize the AlphaFold predicted structure (pLDDT score: 91.14)

    • Perform structure-based function prediction

    • Identify potential ligand binding sites or functional domains

  • Transcriptomic and proteomic profiling:

    • Compare wild-type and XCC2880 mutant expression profiles

    • Identify pathways affected by XCC2880 deletion

    • This approach identified that XC_3388, another protein with unknown function, plays a key role in adaptation and virulence of Xcc

How can researchers investigate post-translational modifications of XCC2880?

Investigating post-translational modifications (PTMs) of membrane proteins like XCC2880 requires specialized techniques:

  • Mass spectrometry-based approaches:

    • Purify XCC2880 from native Xcc or recombinant systems

    • Perform protein digestion with multiple proteases to maximize sequence coverage

    • Analyze using high-resolution MS/MS with fragmentation methods optimized for membrane proteins

    • Use targeted methods (PRM/MRM) for quantifying specific modifications

  • Site-directed mutagenesis:

    • Identify potential modification sites through in silico prediction

    • Generate site-specific mutants (e.g., change potential phosphorylation sites from Ser/Thr to Ala)

    • Compare function of wild-type and mutant proteins

  • Modification-specific detection methods:

    • Use phospho-specific antibodies for potential phosphorylation sites

    • Apply periodate oxidation for glycosylation detection

    • Use click chemistry approaches for lipid modifications

  • Cell-derived membrane vesicle isolation:

    • Study the protein in its native membrane environment to preserve labile modifications

    • These methods can achieve high resolution (2.7-3.8 Å) suitable for detecting PTMs

  • Comparative analysis across growth conditions:

    • Compare modifications under different growth conditions or during infection

    • Analyze samples from different stages of the Xcc life cycle

What is the predicted membrane topology of XCC2880 and how can it be experimentally verified?

Based on the amino acid sequence and AlphaFold prediction, XCC2880 likely has multiple transmembrane domains. To experimentally verify its topology:

How might the function of XCC2880 be related to Xanthomonas pathogenicity and host adaptation?

While the specific function of XCC2880 is not established in the search results, we can hypothesize potential roles in pathogenicity based on contextual information:

  • Potential involvement in infection process:
    Xcc enters plants through hydathodes (natural openings at leaf margins) and then spreads through the xylem system . As a membrane protein, XCC2880 could potentially be involved in:

    • Adaptation to the plant environment during infection

    • Nutrient acquisition in the nutrient-limited xylem

    • Protection against plant defense responses

  • Comparative analysis with known virulence factors:
    Genome-wide studies have identified several factors important for Xcc fitness during plant infection:

    • 181 genes important for fitness were identified in plant-associated environments

    • These showed functional enrichment in genes involved in metabolism

    • Some hypothetical proteins (like XC_3388) play key roles in adaptation and virulence

  • Methodology for investigating XCC2880's role in pathogenicity:

    • Generate knockout mutants and assess virulence using established plant inoculation methods

    • Use hydathode inoculation protocols (dipping leaves in bacterial suspension adjusted to OD600 = 0.1)

    • Assess bacterial populations in planta by tissue sampling and quantification

    • Compare gene expression profiles between in vitro growth and in planta conditions

  • Integration with systems biology approaches:

    • Whole genome microarray studies have identified core sets of conserved genes in Xcc (3405 conserved coding sequences)

    • Determine if XCC2880 is part of the core genome and conserved across Xcc strains

    • Analyze if XCC2880 expression changes during different stages of infection

What are the optimal conditions for functional assays with recombinant XCC2880?

For functional characterization of recombinant XCC2880, consider these research-validated conditions:

  • Buffer systems:

    • Tris/PBS-based buffers at pH 8.0 appear optimal for stability

    • Consider including 6% trehalose for increased stability

  • Membrane protein reconstitution options:

    • Reconstitution in liposomes using lipids that mimic bacterial membranes

    • Nanodiscs with MSP (membrane scaffold proteins) for a more defined system

    • Native nanodiscs using SMALPs (styrene-maleic acid lipid particles) to extract the protein with surrounding lipids

  • Temperature considerations:

    • Functional assays should consider the optimal growth temperature of Xcc (25-30°C)

    • Stability testing at various temperatures to determine optimal assay conditions

  • Control experiments:

    • Include denatured protein controls

    • Use site-directed mutants of conserved residues

    • Compare with homologous UPF0060 proteins from other bacteria

  • Detection methods:

    • If transport function is suspected, consider fluorescent substrate analogs

    • For potential enzymatic activity, use coupled enzyme assays

    • For structural studies, circular dichroism can verify proper folding

How can researchers express sufficient quantities of functional XCC2880 for structural studies?

Obtaining sufficient quantities of properly folded membrane proteins like XCC2880 for structural studies presents several challenges. The following optimized approach is recommended:

  • Expression system selection:

    • E. coli is the standard expression system for recombinant XCC2880

    • Consider specialized E. coli strains designed for membrane protein expression (C41(DE3), C43(DE3), or Lemo21(DE3))

    • For difficult cases, consider alternate expression systems like Pichia pastoris or insect cells

  • Expression vector optimization:

    • Use strong, inducible promoters with tight regulation

    • Include fusion tags that can enhance folding (MBP, SUMO)

    • Retain the His-tag for purification purposes

    • Consider codon optimization for the expression host

  • Induction and growth conditions:

    • Lower temperatures (16-25°C) often improve membrane protein folding

    • Test different induction strategies (IPTG concentration, time of induction)

    • Consider auto-induction media for gradual protein expression

  • Membrane fraction isolation:

    • Gentle lysis methods to preserve native membrane structure

    • Differential centrifugation to separate inner and outer membranes

    • Consider studying the protein directly in membrane vesicles

  • Protein quality assessment:

    • Size-exclusion chromatography to verify monodispersity

    • Thermal stability assays to optimize buffer conditions

    • Functional assays to confirm proper folding

  • Scale-up considerations:

    • Bioreactor cultivation for large-scale production

    • Optimize aeration parameters for high-density culture

    • Consider fed-batch approaches to maximize yield

How can structural information about XCC2880 contribute to understanding bacterial adaptation mechanisms?

The structural information from AlphaFold (pLDDT score: 91.14) and potential experimental structures can provide insights into bacterial adaptation mechanisms:

  • Evolutionary conservation analysis:

    • Compare XCC2880 structure with homologs from other bacteria

    • Identify conserved structural features versus species-specific adaptations

    • Map conservation onto the 3D structure to identify functional regions

  • Structural basis for environment sensing:

    • Membrane proteins often function as sensors of environmental conditions

    • Structural analysis can reveal potential ligand-binding sites

    • Conformational changes in response to environmental factors

  • Integration with systems biology:

    • Place XCC2880 in the context of Xcc adaptation networks

    • Compare with other membrane proteins that contribute to fitness in planta

    • Identify potential interaction partners based on structural complementarity

  • Contribution to plant-microbe interactions:

    • Structural features that may be involved in host adaptation

    • Potential interfaces for interaction with plant cell components

    • Comparison with other membrane proteins involved in plant-pathogen interactions

What insights can comparative genomics provide about the evolution and conservation of XCC2880 across Xanthomonas species?

Comparative genomic analysis can reveal important insights about XCC2880's evolution and significance:

  • Conservation across Xanthomonas pathovars:

    • Xanthomonas campestris has been refined into three main pathovars with different host specificities

    • Compare XCC2880 sequences across these pathovars to determine if it's conserved

    • Assess if sequence variations correlate with host specialization

  • Presence in core genome versus accessory genome:

    • Studies have identified a core set of 3405 conserved coding sequences across Xcc isolates

    • Determining if XCC2880 is part of this core genome would suggest fundamental importance

    • Alternatively, variability might indicate adaptive roles

  • Synteny analysis:

    • Examine the genomic context of XCC2880 across Xanthomonas genomes

    • Conserved genomic neighborhoods often indicate functional relationships

    • Identify potentially co-regulated genes

  • Selection pressure analysis:

    • Calculate dN/dS ratios to determine if XCC2880 is under purifying or diversifying selection

    • Identify specific amino acid positions under selection

    • Map these positions onto the 3D structure to infer functional significance

  • Horizontal gene transfer assessment:

    • Determine if XCC2880 shows evidence of horizontal acquisition

    • Compare with homologs in distantly related bacterial species

    • Analyze GC content and codon usage for evidence of recent transfer

Comparative genomic studies can provide valuable context for experimental work and help prioritize functional hypotheses for XCC2880.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.