Recombinant Xanthomonas campestris pv. juglandis Probable quinate dehydrogenase (quinone) (qumA)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we will prioritize shipping the format currently in stock, we are happy to accommodate any specific format requirements. Please indicate your preference when placing your order, and we will prepare the product accordingly.
Lead Time
Delivery times may vary depending on the purchase method and location. For specific delivery timelines, please contact your local distributors.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipment, please inform us in advance as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we suggest adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard final concentration of glycerol is 50%, which can serve as a reference.
Shelf Life
The shelf life of our products is influenced by various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. For the lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
Tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
qumA; Probable quinate dehydrogenase; quinone
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-790
Protein Length
full length protein
Species
Xanthomonas campestris pv. juglandis (Xanthomonas arboricola pv. juglandis)
Target Names
qumA
Target Protein Sequence
MLIALVGLIFLLGGARLASLGGSWYFLLMGLATALAGVLIVLRRPAGALVYGVAFALTLV WALWDAGLEFWPLVSRLMLPAAFAVLVALAWPALRRSRALPTGRTAYGVATVLALAVVAG IGGMFVPHPPVAGNAGPGMTAVPPGSVQQNWSAYGNTDGGSRFAALDQINRSNGRPAAGS PGPTTPGEIANSDGNGAEDQLTPLQVGEKVFLCTPHNNLIALDASTGKQLWRREINATSS VWQRCRGLGYFDADAALPAPSVANPSPIAAVTVAQGANCRRRLFTNTIDGRLIAVDADTG AFCQGFGSNGQVDLKAGLGAAPDPFYQLTSPPLVAGTTVVGGRTRADDNVQTDMPGGVVR GSMWSPVRSAGLDPGNPHDRQAPAAGSSYVRSTPNVWAPMSYDAAMNTVFLPLGGPSTDL YGAERTALDHRYGASVLALDATTGAEKWVYQTVHNDLWDFDLPMQPSLIDFPNQDGSHTP AVVIGTKAGQIYVLDRATGKPLTEVREVPVKGSDIAHEQYAPTQPLSVGMPQIGTKHLTE SDMWGATAMDQMLCRIAFKQMRYEGLYTAPGTDVSLSFPGSLGGMNWGGLSTDPVHDVVF ANDMRLGLWVQMIPADTRKAEAAGGGEAVNTGMGAVPLKGTPYAVNKNRFLSALGIPCQA PPYGTLSAIDLKTRSIAWQVPVGTVQDTGPFGIKMHLPIPIGMPTLGGTLSTQGGLVFIA GTQDYYLRAFDSATGKELWKGRLPVGSQGGPITYVSHKTGKQYVVISAGGARQSPDRGDY VIAYSLPDAH
Uniprot No.

Target Background

Protein Families
Bacterial PQQ dehydrogenase family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is qumA and what is its role in Xanthomonas campestris pv. juglandis?

The qumA gene encodes a probable quinate dehydrogenase (quinone) in Xanthomonas campestris pv. juglandis. This enzyme is involved in the quinate metabolism pathway, which contributes to the bacterium's ability to catabolize plant-derived aromatic compounds. Specifically, it catalyzes the reversible oxidation of quinate to 3-dehydroquinate using NAD(H) as a cofactor. In the context of plant-pathogen interactions, quinate metabolism may play a role in the bacterium's ability to utilize plant-derived compounds during infection and colonization processes .

How does qumA relate to the pathogenicity of X. campestris pv. juglandis?

While direct evidence linking qumA to pathogenicity is limited in the current literature, Xanthomonas campestris pv. juglandis is the causative agent of walnut blight, a significant bacterial disease affecting walnut production worldwide. The metabolism of plant-derived compounds, including quinate, may contribute to bacterial fitness during infection. The ability to catabolize these compounds could provide a competitive advantage during host colonization, potentially affecting virulence. Research suggests that mutations in metabolic pathways can impact in planta growth and symptom development in Xanthomonas species .

How is the qumA gene used in molecular identification of X. campestris pv. juglandis?

The qumA gene serves as a molecular marker for identification of Xanthomonas arboricola pathovars. Species-specific primers targeting the qumA gene (XarbQ-F qumA: 5′-GCGCGAGATCAATGCGACCTCGTC-3′ and XarbQ-R qumA: 5′-GGTGACCACATCGAACCGCGCA-3′) have been developed for PCR-based detection and identification of X. arboricola species, including pv. juglandis. This molecular approach complements traditional biochemical and physiological tests, providing more accurate identification of the pathogen from environmental and plant samples .

What are the structural characteristics of quinate dehydrogenase enzymes?

Quinate dehydrogenase belongs to the family of shikimate/quinate dehydrogenases. Based on structural analyses of related enzymes such as the dual-substrate quinate/shikimate dehydrogenase (QSDH) from Corynebacterium glutamicum, these enzymes typically feature a binding domain for the NAD(H) cofactor and a substrate-binding pocket that can accommodate either quinate or shikimate. Crystal structures have revealed the molecular basis for substrate discrimination and cofactor specificity. The enzyme forms binary complexes with NAD+ and ternary complexes with NADH plus either shikimate or quinate. The structural arrangement of amino acid residues within the active site determines the preference for quinate versus shikimate .

How do substrate specificity and cofactor dependency vary among quinate dehydrogenases?

Quinate dehydrogenases show varying substrate preferences and cofactor dependencies across different organisms. For example, the QSDH from C. glutamicum exhibits a clear preference for quinate over shikimate, both at its pH optimum and in physiological pH ranges. This contrasts with closely related SDH/QDH enzymes that may favor shikimate. Regarding cofactor utilization, some QDHs are strictly NAD(H)-dependent, while others may utilize NADP(H). These variations in substrate specificity and cofactor dependency can be explained through structural analysis and sequence comparisons, which reveal differences in the amino acid residues that line the substrate binding pocket and interact with the cofactor .

What distinguishes enzymes with QDH activity from those with SDH activity?

Despite similarities in reaction mechanisms, enzymes with predominant QDH activity can be distinguished from those with SDH activity based on specific amino acid residues in the substrate binding pocket. In plants like poplar, genes encoding DQD/SDH-like proteins have diverged into distinct groups. Some of these proteins (e.g., Poptr1 and Poptr5) function as true DQD/SDHs, while others (e.g., Poptr2 and Poptr3) have evolved QDH activity with only residual DQD/SDH activity. This functional divergence is reflected in protein structure and sequence analysis, where specific amino acid substitutions in the substrate binding region confer the ability to preferentially bind and catalyze the conversion of quinate rather than shikimate .

What are the optimal conditions for expressing recombinant qumA in E. coli?

For optimal expression of recombinant qumA from X. campestris pv. juglandis in E. coli, researchers typically use expression vectors with inducible promoters such as T7 or tac. Based on protocols for similar enzymes, expression conditions often include:

  • Growth at 28-30°C (rather than 37°C) to enhance protein solubility

  • Induction with lower concentrations of IPTG (0.1-0.5 mM)

  • Extended expression periods (16-24 hours)

  • Supplementation with cofactors (NAD+ or NADH) during protein purification

E. coli is the preferred host for recombinant production as indicated in product information for commercially available recombinant qumA . The expressed protein is typically stored in a liquid form containing glycerol to maintain stability during freeze-thaw cycles.

What methods are most effective for measuring qumA enzymatic activity?

Enzymatic activity of qumA can be measured using spectrophotometric assays that monitor the reduction of NAD+ to NADH (or vice versa) at 340 nm. Based on protocols for related enzymes, a typical assay mixture would contain:

ComponentConcentration
Tris-HCl buffer (pH 8.0-9.0)50-100 mM
Quinate1-5 mM
NAD+0.5-2 mM
Enzyme0.1-1 µg
Total volume1 mL

The reaction is initiated by adding the enzyme and monitored continuously at 25-30°C. For the reverse reaction, 3-dehydroquinate and NADH are used as substrates. Kinetic parameters (Km, Vmax) can be determined by varying substrate concentrations and analyzing the data using Lineweaver-Burk or nonlinear regression methods .

How can researchers optimize long-term storage of recombinant qumA protein?

For optimal long-term storage of recombinant qumA, the following recommendations apply:

  • Store concentrated protein at -20°C for routine use, or at -80°C for extended storage periods

  • Avoid repeated freeze-thaw cycles, which can lead to protein denaturation and loss of activity

  • Prepare working aliquots and store at 4°C for up to one week to minimize freeze-thaw cycles

  • Include glycerol (20-25%) in the storage buffer to prevent ice crystal formation

  • Add reducing agents like DTT or β-mercaptoethanol to prevent oxidation of sulfhydryl groups

  • Consider adding stabilizers such as bovine serum albumin (BSA) for dilute protein solutions

These storage conditions help maintain enzymatic activity over extended periods, as indicated in handling recommendations for commercial recombinant qumA preparations .

How can qumA-based PCR be optimized for detection of X. campestris pv. juglandis in field samples?

Optimization of qumA-based PCR for detection of X. campestris pv. juglandis in field samples involves several considerations:

  • DNA extraction: Use specialized protocols for plant material that effectively remove PCR inhibitors from walnut tissues

  • Primer design: Utilize the species-specific primers targeting qumA (XarbQ-F and XarbQ-R) for specific amplification

  • PCR conditions: Optimize annealing temperature (typically 60-65°C) and cycle number for maximum specificity and sensitivity

  • Inclusion of internal controls: Use plant DNA-specific primers as internal controls to confirm successful DNA extraction

  • Validation: Compare results with traditional isolation techniques and pathogenicity tests

  • Quantification: Consider developing qPCR protocols for quantitative assessment of bacterial load

This approach allows for rapid and specific detection of the pathogen from symptomatic plant tissues, facilitating early diagnosis and management of walnut blight .

What advantages does qumA-based identification offer over traditional methods?

qumA-based molecular identification of X. campestris pv. juglandis offers several advantages over traditional microbiological methods:

  • Speed: Results can be obtained within hours rather than days required for culture-based methods

  • Specificity: The qumA gene provides specific identification of X. arboricola pathovars

  • Sensitivity: PCR-based detection can identify the pathogen at low concentrations

  • Applicability to non-culturable states: Can detect viable but non-culturable bacteria

  • Multiplexing capability: Can be combined with primers for other pathogens for simultaneous detection

  • Quantification potential: When adapted to qPCR, allows quantitative assessment of bacterial load

These advantages make qumA-based identification particularly valuable for epidemiological studies and disease management strategies .

How does quinate metabolism integrate with other metabolic pathways in Xanthomonas?

Quinate metabolism in Xanthomonas integrates with several key metabolic pathways:

  • Shikimate pathway: Quinate metabolism connects with the shikimate pathway at the level of 3-dehydroquinate, a key intermediate in aromatic amino acid biosynthesis

  • Aromatic compound catabolism: Enables utilization of plant-derived phenolic compounds

  • Lignin degradation: May contribute to the bacterium's ability to degrade plant cell wall components

  • Carbon utilization: Provides alternative carbon sources during plant colonization

  • TCA cycle: The products of quinate catabolism feed into central carbon metabolism

This metabolic integration allows Xanthomonas to flexibly utilize various plant-derived compounds, potentially contributing to its fitness as a plant pathogen .

What role might qumA play in the ecological interaction between X. campestris pv. juglandis and walnut trees?

The qumA enzyme may play several roles in the ecological interaction between X. campestris pv. juglandis and walnut trees:

  • Nutrient acquisition: Enabling the bacterium to utilize quinate, a plant-derived compound, as a carbon source

  • Detoxification: Converting potentially toxic plant defense compounds to less harmful forms

  • Adaptation to the host environment: Facilitating growth in plant tissues where quinate is present

  • Competitive advantage: Providing metabolic capabilities that may not be present in competing microorganisms

  • Biofilm formation: Potentially contributing to the bacterium's ability to form biofilms on plant surfaces

Understanding these ecological aspects could inform strategies for disease management in walnut orchards, particularly as alternatives to traditional copper-based treatments are being sought .

How can understanding qumA function contribute to developing alternative control methods for walnut blight?

Understanding qumA function could contribute to alternative control strategies for walnut blight in several ways:

  • Enzyme inhibitor development: Identifying specific inhibitors of qumA that could disrupt bacterial metabolism

  • Bacteriophage therapy: Selecting or engineering bacteriophages that target X. campestris pv. juglandis based on metabolic dependencies

  • Biocontrol agents: Developing competing microorganisms that interfere with quinate utilization

  • Resistant cultivar development: Selecting walnut varieties with altered quinate content or metabolism

  • Metabolic-based diagnostics: Creating rapid detection methods based on quinate metabolism

Current research indicates that bacteriophage therapy shows promise as an alternative to copper compounds for controlling walnut blight, with similar efficacy in reducing disease incidence and severity. This approach significantly reduces bacterial load in walnut tissue compared to conventional treatments .

How does qumA from X. campestris pv. juglandis compare with similar enzymes from other bacteria?

Comparative analysis of qumA from X. campestris pv. juglandis with similar enzymes from other bacteria reveals:

These comparative analyses provide insights into the evolution of metabolic capabilities across bacterial taxa and can inform protein engineering efforts .

What evolutionary patterns are observed in the diversification of SDH/QDH enzyme families?

The SDH/QDH enzyme family shows interesting evolutionary patterns of functional diversification:

  • Gene duplication and divergence: In many organisms, gene duplication events have led to multiple family members with specialized functions

  • Substrate specificity shifts: Evolution from primarily SDH activity to QDH activity through specific amino acid substitutions

  • Cofactor preference adaptation: Changes in binding pocket residues that determine NAD(H) versus NADP(H) preference

  • Domain fusion events: In plants, the fusion of dehydroquinate dehydratase (DQD) and shikimate dehydrogenase (SDH) domains created bifunctional enzymes

  • Convergent evolution: Similar functional adaptations occurring independently in different lineages

In poplar, for example, five DQD/SDH-like genes have diverged into distinct groups, with some enzymes maintaining the ancestral DQD/SDH activity (Poptr1, Poptr5) while others have evolved QDH activity (Poptr2, Poptr3) .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.